Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PTPRT AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Rabbit PTPRT Polyclonal Antibody | anti-PTPRT antibody

PTPRT antibody - C-terminal region

Gene Names
PTPRT; RPTPrho
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PTPRT; Polyclonal Antibody; PTPRT antibody - C-terminal region; anti-PTPRT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WPAYRDTPPSKRSLLKVVRRLEKWQEQYDGREGRTVVHCLNGGGRSGTFC
Sequence Length
1441
Applicable Applications for anti-PTPRT antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PTPRT AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Western Blot (WB) (WB Suggested Anti-PTPRT AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Related Product Information for anti-PTPRT antibody
This is a rabbit polyclonal antibody against PTPRT. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracellular catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains a meprin-A5 antigen-PTP (MAM) domain, Ig-like and fibronectin type III-like repeats. The protein domain structure and the expression pattern of the mouse counterpart of this PTP suggest its roles in both signal transduction and cellular adhesion in the central nervous system. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported.
Product Categories/Family for anti-PTPRT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
160kDa
NCBI Official Full Name
receptor-type tyrosine-protein phosphatase T isoform 2
NCBI Official Synonym Full Names
protein tyrosine phosphatase receptor type T
NCBI Official Symbol
PTPRT
NCBI Official Synonym Symbols
RPTPrho
NCBI Protein Information
receptor-type tyrosine-protein phosphatase T
UniProt Protein Name
Receptor-type tyrosine-protein phosphatase T
UniProt Gene Name
PTPRT
UniProt Synonym Gene Names
KIAA0283; R-PTP-T; RPTP-rho
UniProt Entry Name
PTPRT_HUMAN

NCBI Description

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracellular catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains a meprin-A5 antigen-PTP (MAM) domain, Ig-like and fibronectin type III-like repeats. The protein domain structure and the expression pattern of the mouse counterpart of this PTP suggest its roles in both signal transduction and cellular adhesion in the central nervous system. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

PTPRT iso1: May be involved in both signal transduction and cellular adhesion in the CNS. Belongs to the protein-tyrosine phosphatase family. Receptor class 2B subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.48; Membrane protein, integral; Motility/polarity/chemotaxis; Receptor protein phosphatase, tyrosine

Chromosomal Location of Human Ortholog: 20q12-q13

Cellular Component: cell surface; integral to membrane; plasma membrane

Molecular Function: protein binding; cadherin binding; gamma-catenin binding; beta-catenin binding; protein tyrosine phosphatase activity; alpha-catenin binding

Biological Process: signal transduction; homophilic cell adhesion; cell adhesion; protein amino acid dephosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on PTPRT

Similar Products

Product Notes

The PTPRT ptprt (Catalog #AAA3216029) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTPRT antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PTPRT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTPRT ptprt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WPAYRDTPPS KRSLLKVVRR LEKWQEQYDG REGRTVVHCL NGGGRSGTFC. It is sometimes possible for the material contained within the vial of "PTPRT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.