Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Mouse anti-Human, Mouse ERF Monoclonal Antibody | anti-ERF antibody

ERF (ETS Domain-containing Transcription Factor ERF, Ets2 Repressor Factor, PE-2) (AP)

Gene Names
ERF; PE2; CRS4; PE-2
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ERF; Monoclonal Antibody; ERF (ETS Domain-containing Transcription Factor ERF; Ets2 Repressor Factor; PE-2) (AP); anti-ERF antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F11
Specificity
Recognizes human ERF. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ERF antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa181-290 from human ERF (AAH22231) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(ERF monoclonal antibody. Western Blot analysis of ERF expression in Raw 264.7.)

Western Blot (WB) (ERF monoclonal antibody. Western Blot analysis of ERF expression in Raw 264.7.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ERF on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ERF on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-ERF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
49,965 Da
NCBI Official Full Name
Homo sapiens Ets2 repressor factor, mRNA
NCBI Official Synonym Full Names
ETS2 repressor factor
NCBI Official Symbol
ERF
NCBI Official Synonym Symbols
PE2; CRS4; PE-2
NCBI Protein Information
ETS domain-containing transcription factor ERF
Protein Family

NCBI Description

ETS2 is a transcription factor and protooncogene involved in development, apoptosis, and the regulation of telomerase. The protein encoded by this gene binds to the ETS2 promoter and is a strong repressor of ETS2 transcription. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]

Research Articles on ERF

Similar Products

Product Notes

The ERF (Catalog #AAA6131165) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ERF (ETS Domain-containing Transcription Factor ERF, Ets2 Repressor Factor, PE-2) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ERF can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ERF for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ERF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.