Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SETMARSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SETMAR Polyclonal Antibody | anti-SETMAR antibody

SETMAR Antibody - middle region

Gene Names
SETMAR; Mar1; METNASE
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SETMAR; Polyclonal Antibody; SETMAR Antibody - middle region; anti-SETMAR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELS
Sequence Length
365
Applicable Applications for anti-SETMAR antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SETMAR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SETMARSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SETMARSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SETMAR antibody
This gene encodes a fusion protein that contains an N-terminal histone-lysine N-methyltransferase domain and a C-terminal mariner transposase domain. The encoded protein binds DNA and functions in DNA repair activities including non-homologous end joining and double strand break repair. The SET domain portion of this protein specifically methylates histone H3 lysines 4 and 36. This gene exists as a fusion gene only in anthropoid primates, other organisms lack mariner transposase domain. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-SETMAR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41 kDa
NCBI Official Full Name
Histone-lysine N-methyltransferase SETMAR
NCBI Official Synonym Full Names
SET domain and mariner transposase fusion gene
NCBI Official Symbol
SETMAR
NCBI Official Synonym Symbols
Mar1; METNASE
NCBI Protein Information
histone-lysine N-methyltransferase SETMAR
UniProt Protein Name
Histone-lysine N-methyltransferase SETMAR
UniProt Gene Name
SETMAR
UniProt Synonym Gene Names
Metnase
UniProt Entry Name
SETMR_HUMAN

NCBI Description

This gene encodes a fusion protein that contains an N-terminal histone-lysine N-methyltransferase domain and a C-terminal mariner transposase domain. The encoded protein binds DNA and functions in DNA repair activities including non-homologous end joining and double strand break repair. The SET domain portion of this protein specifically methylates histone H3 lysines 4 and 36. This gene exists as a fusion gene only in anthropoid primates, other organisms lack mariner transposase domain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]

Uniprot Description

SETMAR: Histone methyltransferase that methylates 'Lys-4' and 'Lys-36' of histone H3, 2 specific tags for epigenetic transcriptional activation. Specifically mediates dimethylation of H3 'Lys-36'. Has sequence-specific DNA-binding activity and recognizes the 19-mer core of the 5'-terminal inverted repeats (TIRs) of the Hsmar1 element. Has DNA nicking activity. Has in vivo end joining activity and may mediate genomic integration of foreign DNA. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - lysine degradation; EC 2.1.1.43; Methyltransferase; Methyltransferase, protein lysine

Chromosomal Location of Human Ortholog: 3p26.1

Cellular Component: condensed chromosome; nucleus

Molecular Function: protein binding; structure-specific DNA binding; protein homodimerization activity; zinc ion binding; single-stranded DNA specific endodeoxyribonuclease activity; histone lysine N-methyltransferase activity (H3-K4 specific); endonuclease activity; double-stranded DNA binding; single-stranded DNA binding; transposase activity; histone lysine N-methyltransferase activity (H3-K36 specific)

Biological Process: cell proliferation; DNA integration; histone H3-K4 methylation; DNA double-strand break processing; histone H3-K36 methylation; transposition, DNA-mediated; DNA catabolic process, endonucleolytic; double-strand break repair via nonhomologous end joining; replication fork processing

Research Articles on SETMAR

Similar Products

Product Notes

The SETMAR setmar (Catalog #AAA3222584) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SETMAR Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SETMAR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SETMAR setmar for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VDPTYIGNIG RFLNHSCEPN LLMIPVRIDS MVPKLALFAA KDIVPEEELS. It is sometimes possible for the material contained within the vial of "SETMAR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.