Mouse EPHB3 Monoclonal Antibody | anti-EPHB3 antibody

EPHB3 (EPH Receptor B3, ETK2, HEK2, TYRO6) (APC)

Cat. Num. AAA6167287

• Gene Names: EPHB3; EK2; ETK2; HEK2; TYRO6
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: EPHB3; Monoclonal Antibody; EPHB3 (EPH Receptor B3; ETK2; HEK2; TYRO6) (APC); EPH Receptor B3; TYRO6; anti-EPHB3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3F12
• Specificity: Recognizes EPHB3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-EPHB3 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: EPHB3 (NP_004434, 899aa-997aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(EPHB3 monoclonal antibody (M10), clone 3F12 Western Blot analysis of EPHB3 expression in NIH/3T3.)

Immunoprecipitation (IP)

(Immunoprecipitation of EPHB3 transfected lysate using anti-EPHB3 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with EPHB3 monoclonal antibody.)

Western Blot (WB)

(Western Blot analysis of EPHB3 expression in transfected 293T cell line by EPHB3 monoclonal antibody (M10), clone 3F12.Lane 1: EPHB3 transfected lysate (Predicted MW: 110.3 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-EPHB3 antibody

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq]

Product Categories/Family for anti-EPHB3 antibody

Antibodies; Receptors; Tyrosine Kinase

NCBI and Uniprot Product Information

• NCBI GI #: 17975768
• NCBI GeneID: 2049
• NCBI Accession #: NP_004434
• NCBI GenBank Nucleotide #: NM_004443
• UniProt Accession #: P54753
• Molecular Weight: 107kDa
• NCBI Official Full Name: ephrin type-B receptor 3
• NCBI Official Synonym Full Names: EPH receptor B3
• NCBI Official Symbol: EPHB3
• NCBI Official Synonym Symbols: EK2; ETK2; HEK2; TYRO6
• NCBI Protein Information: ephrin type-B receptor 3
• UniProt Protein Name: Ephrin type-B receptor 3
• Protein Family: Ephrin type-B receptor
• UniProt Gene Name: EPHB3
• UniProt Synonym Gene Names: ETK2; HEK2; TYRO6; EPH-like kinase 2; EK2; hEK2
• UniProt Entry Name: EPHB3_HUMAN

NCBI Description

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into two groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. This gene encodes a receptor for ephrin-B family members. [provided by RefSeq, Mar 2010]

Uniprot Description

EphB3: a ubiquitous receptor tyrosine kinase of the Eph family. A receptor for ephrin-B family members: ephrin-B1 and -B2. The Eph receptor tyrosine kinase family, the largest in the tyrosine kinase group, has fourteen members. They bind membrane-anchored ligands, ephrins, at sites of cell-cell contact, regulating the repulsion and adhesion of cells that underlie the establishment, maintenance, and remodeling of patterns of cellular organization. Eph signals are particularly important in regulating cell adhesion and cell migration during development, axon guidance, homeostasis and disease. EphA receptors bind to GPI-anchored ephrin-A ligands, while EphB receptors bind to ephrin-B proteins that have a transmembrane and cytoplasmic domain. Interactions between EphB receptor kinases and ephrin-B proteins transduce signals bidirectionally, signaling to both interacting cell types. Eph receptors and ephrins also regulate the adhesion of endothelial cells and are required for the remodeling of blood vessels.EphB3 contains 1 sterile alpha motif (SAM) domain and 2 fibronectin type III domains.

Protein type: EC 2.7.10.1; Protein kinase, TK; Kinase, protein; Membrane protein, integral; Protein kinase, tyrosine (receptor); TK group; Eph family

Chromosomal Location of Human Ortholog: 3q27.1

Cellular Component: integral to plasma membrane; dendrite; plasma membrane; extracellular region; cytosol

Molecular Function: ephrin receptor activity; axon guidance receptor activity; ATP binding

Biological Process: axon guidance; cell migration; peptidyl-tyrosine phosphorylation; thymus development; protein amino acid autophosphorylation; axonal fasciculation; central nervous system projection neuron axonogenesis; digestive tract morphogenesis; palate development; regulation of axonogenesis; corpus callosum development; positive regulation of synaptogenesis; regulation of cell-cell adhesion; ephrin receptor signaling pathway; angiogenesis; urogenital system development; retinal ganglion cell axon guidance