Mouse EPHA1 Monoclonal Antibody | anti-EPHA1 antibody

EPHA1 (EPH Receptor A1, EPH, EPHT, EPHT1, MGC163163) (HRP)

Cat. Num. AAA6183461

• Gene Names: EPHA1; EPH; EPHT; EPHT1
• Applications: Western Blot
• Purity: Purified
• Synonyms: EPHA1; Monoclonal Antibody; EPHA1 (EPH Receptor A1; EPH; EPHT; EPHT1; MGC163163) (HRP); EPH Receptor A1; MGC163163; anti-EPHA1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8D4
• Specificity: Recognizes EPHA1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-EPHA1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: EPHA1 (NP_005223, 394aa-500aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PGARGLTTPAVHVNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDEERYQMVLEPR
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged EPHA1 is 1 ng/ml as a capture antibody.)

Product Categories/Family for anti-EPHA1 antibody

Antibodies; Receptors; Tyrosine Kinase

NCBI and Uniprot Product Information

• NCBI GI #: 221316650
• NCBI GeneID: 2041
• NCBI Accession #: NP_005223
• NCBI GenBank Nucleotide #: NM_005232
• UniProt Accession #: P21709; Q15405; A1L3V3; B5A966; B5A967
• Molecular Weight: 51,069 Da
• NCBI Official Full Name: ephrin type-A receptor 1
• NCBI Official Synonym Full Names: EPH receptor A1
• NCBI Official Symbol: EPHA1
• NCBI Official Synonym Symbols: EPH; EPHT; EPHT1
• NCBI Protein Information: ephrin type-A receptor 1; eph tyrosine kinase 1; erythropoietin-producing hepatoma amplified sequence; erythropoietin-producing hepatoma receptor; hEpha1; oncogene EPH; soluble EPHA1 variant 1; soluble EPHA1 variant 2; tyrosine-protein kinase receptor EPH
• UniProt Protein Name: Ephrin type-A receptor 1
• Protein Family: Ephrin type-A receptor
• UniProt Gene Name: EPHA1
• UniProt Synonym Gene Names: EPH; EPHT; EPHT1; hEpha1
• UniProt Entry Name: EPHA1_HUMAN

Uniprot Description

EphA1: a receptor tyrosine kinase. Receptor for members of the ephrin-A family. Binds with a low affinity to ephrin-A1. The Eph receptor tyrosine kinase family, the largest in the tyrosine kinase group, has fourteen members. They bind membrane-anchored ligands, ephrins, at sites of cell-cell contact, regulating the repulsion and adhesion of cells that underlie the establishment, maintenance, and remodeling of patterns of cellular organization. Eph signals are particularly important in regulating cell adhesion and cell migration during development, axon guidance, homeostasis and disease. EphA receptors bind to GPI-anchored ephrin-A ligands, while EphB receptors bind to ephrin-B proteins that have a transmembrane and cytoplasmic domain. Interactions between EphB receptor kinases and ephrin-B proteins transduce signals bidirectionally, signaling to both interacting cell types. Eph receptors and ephrins also regulate the adhesion of endothelial cells and are required for the remodeling of blood vessels. Misexpressed in several cancers, including upregulation in head and neck cancer, and downregulation in invasive breast cancer cell lines and glioblastoma

Protein type: Membrane protein, integral; EC 2.7.10.1; Protein kinase, TK; Protein kinase, tyrosine (receptor); Kinase, protein; TK group; Eph family

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: transmembrane-ephrin receptor activity; protein kinase binding; ATP binding; protein kinase activity

Biological Process: axon guidance; positive regulation of angiogenesis; peptidyl-tyrosine phosphorylation; cell surface receptor linked signal transduction; somatic stem cell maintenance; protein amino acid autophosphorylation; positive regulation of cell proliferation; positive regulation of stress fiber formation; ephrin receptor signaling pathway; negative regulation of protein kinase activity; angiogenesis; positive regulation of cell-matrix adhesion; negative regulation of cell migration; positive regulation of cell migration