Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD))

Mouse anti-Human ENTPD4 Monoclonal Antibody | anti-ENTPD4 antibody

ENTPD4 (KIAA0392, LALP70, LYSAL1, Ectonucleoside Triphosphate Diphosphohydrolase 4, Lysosomal Apyrase-like Protein of 70kD, Uridine-diphosphatase, UDPase) (AP)

Gene Names
ENTPD4; LAP70; LALP70; LYSAL1; UDPase; NTPDase-4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ENTPD4; Monoclonal Antibody; ENTPD4 (KIAA0392; LALP70; LYSAL1; Ectonucleoside Triphosphate Diphosphohydrolase 4; Lysosomal Apyrase-like Protein of 70kD; Uridine-diphosphatase; UDPase) (AP); anti-ENTPD4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4H7
Specificity
Recognizes human ENTPD4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
616
Applicable Applications for anti-ENTPD4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa371-469 from ENTPD4 (NP_004892) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD))

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD))

Testing Data

(Detection limit for recombinant GST tagged ENTPD4 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ENTPD4 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-ENTPD4 antibody
Hydrolyzes preferentially nucleoside 5'-diphosphates, nucleoside 5'-triphosphates are hydrolyzed only to a minor extent. The order of activity with different substrates is UDP >> GDP = CDP = TDP, AMP, ADP, ATP and UMP are not substrates. Preferred substrates for isoform 2 are CTP, UDP, CDP, GTP and GDP, while isoform 1 utilizes UTP and TTP.
Product Categories/Family for anti-ENTPD4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ectonucleoside triphosphate diphosphohydrolase 4 isoform a
NCBI Official Synonym Full Names
ectonucleoside triphosphate diphosphohydrolase 4
NCBI Official Symbol
ENTPD4
NCBI Official Synonym Symbols
LAP70; LALP70; LYSAL1; UDPase; NTPDase-4
NCBI Protein Information
ectonucleoside triphosphate diphosphohydrolase 4
UniProt Protein Name
Ectonucleoside triphosphate diphosphohydrolase 4
UniProt Gene Name
ENTPD4
UniProt Synonym Gene Names
KIAA0392; LALP70; LYSAL1; NTPDase 4; UDPase
UniProt Entry Name
ENTP4_HUMAN

NCBI Description

This gene encodes a member of the apyrase protein family. Apyrases are enzymes that catalyze the hydrolysis of nucleotide diphosphates and triphosphates in a calcium or magnesium-dependent manner. The encoded protein is an endo-apyrase and may play a role in salvaging nucleotides from lysosomes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and these isoforms may differ in divalent cation dependence and substrate specificity. [provided by RefSeq, Sep 2011]

Uniprot Description

UDPase: an ectonucleoside triphosphate diphosphohydrolase. Hydrolyzes preferentially nucleoside 5'-diphosphates; nucleoside 5'-triphosphates are hydrolyzed only to a minor extent. The order of activity with different substrates is UDP >> GDP = CDP = TDP; AMP, ADP, ATP and UMP are not substrates. Two splice variant isoforms have been described. Preferred substrates for isoform 2 are CTP, UDP, CDP, GTP and GDP, while isoform 1 utilizes UTP and TTP

Protein type: Membrane protein, integral; Hydrolase; EC 3.6.1.6; Nucleotide Metabolism - purine; Nucleotide Metabolism - pyrimidine; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 8p21.3

Cellular Component: intracellular membrane-bound organelle; integral to Golgi membrane; cytoplasmic vesicle

Molecular Function: uridine-diphosphatase activity

Biological Process: UDP catabolic process

Research Articles on ENTPD4

Similar Products

Product Notes

The ENTPD4 entpd4 (Catalog #AAA6131133) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ENTPD4 (KIAA0392, LALP70, LYSAL1, Ectonucleoside Triphosphate Diphosphohydrolase 4, Lysosomal Apyrase-like Protein of 70kD, Uridine-diphosphatase, UDPase) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ENTPD4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ENTPD4 entpd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ENTPD4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.