Mouse anti-Human ENO2 Monoclonal Antibody | anti-ENO2 antibody

ENO2 (Gamma-enolase, 2-phospho-D-glycerate hydro-lyase, Enolase 2, Neural Enolase, Neuron-specific Enolase, NSE) (HRP)

Cat. Num. AAA6152340

• Gene Names: ENO2; NSE; HEL-S-279
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ENO2; Monoclonal Antibody; ENO2 (Gamma-enolase; 2-phospho-D-glycerate hydro-lyase; Enolase 2; Neural Enolase; Neuron-specific Enolase; NSE) (HRP); anti-ENO2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A3
• Specificity: Recognizes human ENO2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ENO2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa325-434 from human ENO2 (AAH02745) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(ENO2 monoclonal antibody. Western Blot analysis of ENO2 expression in HeLa.)

Western Blot (WB)

(ENO2 monoclonal antibody. Western Blot analysis of ENO2 expression in different cell lines.)

Western Blot (WB)

(Western Blot analysis of ENO2 expression in transfected 293T cell line by ENO2 monoclonal antibody. Lane 1: ENO2 transfected lysate (47.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ENO2 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-ENO2 antibody

Enolase is a glycolytic enzyme catalyzing the reaction pathway between 2 phospho glycerate and phosphoenol pyruvate. In mammals, enolase molecules are dimers composed of three distinct subunits (alpha, beta and gamma). The alpha subunit is expressed in most tissues and the beta subunit only in muscle. The gamma subunit is expressed primarily in neurons, in normal and in neoplastic neuroendocrine cells. NSE (neuron specific enolase) is found in elevated concentrations in plasma and certain neoplasias. These include pediatric neuroblastoma and small cell lung cancer. Coexpression of NSE and chromogranin A is common in neuroendocrine neoplasms.

Product Categories/Family for anti-ENO2 antibody

Antibodies; Enzymes

References

1. Identification of alpha-Enolase as an Autoantigen in Lung Cancer: Its Overexpression Is Associated with Clinical Outcomes. Chang GC, Liu KJ, Hsieh CL, Hu TS, Charoenfuprasert S, Liu HK, Luh KT, Hsu LH, Wu CW, Ting CC, Chen CY, Chen KC, Yang TY, Chou TY, Wang WH, Whang-Peng J, Shih NY.Clin Cancer Res. 2006 Oct 1;12(19):5746-54.

NCBI and Uniprot Product Information

• NCBI GI #: 33877116
• NCBI GeneID: 2026
• UniProt Accession #: P09104; Q96J33; B7Z2X9
• Molecular Weight: 42,707 Da
• NCBI Official Full Name: Homo sapiens enolase 2 (gamma, neuronal), mRNA
• NCBI Official Synonym Full Names: enolase 2
• NCBI Official Symbol: ENO2
• NCBI Official Synonym Symbols: NSE; HEL-S-279
• NCBI Protein Information: gamma-enolase
• UniProt Protein Name: Gamma-enolase
• Protein Family: Enolase
• UniProt Gene Name: ENO2
• UniProt Synonym Gene Names: NSE
• UniProt Entry Name: ENOG_HUMAN

NCBI Description

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. [provided by RefSeq, Jul 2008]

Uniprot Description

ENO2: an enzyme with 2-phospho-D-glycerate hydro-lyase activity. One of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Lyase; EC 4.2.1.11

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: extracellular space; photoreceptor inner segment; phosphopyruvate hydratase complex; plasma membrane; perikaryon; cytosol

Molecular Function: magnesium ion binding; phosphopyruvate hydratase activity

Biological Process: glycolysis; carbohydrate metabolic process; glucose metabolic process; pathogenesis; gluconeogenesis