Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human Endothelin 1 Monoclonal Antibody | anti-EDN1 antibody

Endothelin 1 (Endothelin-1, EDN1, ET1, ET-1, HDLCQ7, Preproendothelin-1, PPET1) (PE)

Gene Names
EDN1; ET1; QME; PPET1; ARCND3; HDLCQ7
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Endothelin 1; Monoclonal Antibody; Endothelin 1 (Endothelin-1; EDN1; ET1; ET-1; HDLCQ7; Preproendothelin-1; PPET1) (PE); anti-EDN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D6
Specificity
Recognizes human EDN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-EDN1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa113-212 from human EDN1 (AAH09720) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of EDN1 expression in transfected 293T cell line by EDN1 monoclonal antibody. Lane 1: EDN1 transfected lysate (24kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EDN1 expression in transfected 293T cell line by EDN1 monoclonal antibody. Lane 1: EDN1 transfected lysate (24kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of EDN1 transfected lysate using EDN1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with EDN1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of EDN1 transfected lysate using EDN1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with EDN1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged EDN1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EDN1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-EDN1 antibody
Endothelins (ET) show potent constrictor activity in vascular and non-vascular smooth muscle. This family of 21aa peptides exists in at least three isoforms, ET-1, ET-2, and ET-3, and is produced in endothelial and epithelial cells. ET's can mediate biological effects in cells and tissues, and have been shown to bind to an ET receptor in the lung, kidney, heart and liver.
Product Categories/Family for anti-EDN1 antibody
References
1. Calpain-6 is an endothelin-1 signaling dependent protective factor in chemoresistant osteosarcoma. Marion A, Dieudonne FX, Patino-Garcia A, Lecanda F, Marie PJ, Modrowski D.Int J Cancer. 2012 Jun 1;130(11):2514-25. doi: 10.1002/ijc.26246. Epub 2011 Aug 16. 2. Endothelin type A and B receptors in the control of afferent and efferent arterioles in mice. Schildroth J, Rettig-Zimmermann J, Kalk P, Steege A, Fahling M, Sendeski M, Paliege A, Lai EY, Bachmann S, Persson PB, Hocher B, Patzak A.Nephrol Dial Transplant. 2010 Sep 2. 3. Epithelial-to-Mesenchymal Transition and Resistance to Ingenol 3-Angelate, a Novel Protein Kinase C Modulator, in Colon Cancer Cells. Ghoul A, Serova M, Astorgues-Xerri L, Bieche I, Bousquet G, Varna M, Vidaud M, Phillips E, Weill S, Benhadji KA, Lokiec F, Cvitkovic E, Faivre S, Raymond E.Cancer Res. 2009 May 15;69(10):4260-9. Epub 2009 May 5.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
24,425 Da
NCBI Official Full Name
Homo sapiens endothelin 1, mRNA
NCBI Official Synonym Full Names
endothelin 1
NCBI Official Symbol
EDN1
NCBI Official Synonym Symbols
ET1; QME; PPET1; ARCND3; HDLCQ7
NCBI Protein Information
endothelin-1
Protein Family

NCBI Description

This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant expression of this gene may promote tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

Research Articles on EDN1

Similar Products

Product Notes

The EDN1 (Catalog #AAA6157640) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Endothelin 1 (Endothelin-1, EDN1, ET1, ET-1, HDLCQ7, Preproendothelin-1, PPET1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Endothelin 1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EDN1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Endothelin 1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.