Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PTK9L monoclonal antibody Western Blot analysis of TWF2 expression in human liver.)

Mouse anti-Human PTK9L Monoclonal Antibody | anti-TWF2 antibody

PTK9L (TWF2, PTK9L, Twinfilin-2, A6-related Protein, Protein Tyrosine Kinase 9-like, Twinfilin-1-like Protein)

Gene Names
TWF2; A6r; A6RP; PTK9L; MSTP011
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PTK9L; Monoclonal Antibody; PTK9L (TWF2; Twinfilin-2; A6-related Protein; Protein Tyrosine Kinase 9-like; Twinfilin-1-like Protein); Anti -PTK9L (TWF2; anti-TWF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B5
Specificity
Recognizes human PTK9L.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
FAGYQKHLSSCAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAFPLQPEAQRALQQLKQKMVNYIQMKLDLERETIELVHTEPTDVAQLPSRVP
Applicable Applications for anti-TWF2 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa131-230 from PTK9L (AAH00327) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PTK9L monoclonal antibody Western Blot analysis of TWF2 expression in human liver.)

Western Blot (WB) (PTK9L monoclonal antibody Western Blot analysis of TWF2 expression in human liver.)
Related Product Information for anti-TWF2 antibody
The protein encoded by this gene was identified by its interaction with the catalytic domain of protein kinase C-zeta. The encoded protein contains an actin-binding site and an ATP-binding site. It is most closely related to twinfilin (PTK9), a conserved actin monomer-binding protein.
Product Categories/Family for anti-TWF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
39,548 Da
NCBI Official Full Name
PTK9L
NCBI Official Synonym Full Names
twinfilin actin-binding protein 2
NCBI Official Symbol
TWF2
NCBI Official Synonym Symbols
A6r; A6RP; PTK9L; MSTP011
NCBI Protein Information
twinfilin-2; A6-related protein; twinfilin-1-like protein; twinfilin, actin-binding protein, homolog 2; protein tyrosine kinase 9-like (A6-related protein); PTK9L protein tyrosine kinase 9-like (A6-related protein)
UniProt Protein Name
Twinfilin-2
Protein Family
UniProt Gene Name
TWF2
UniProt Synonym Gene Names
PTK9L; hA6RP
UniProt Entry Name
TWF2_HUMAN

NCBI Description

The protein encoded by this gene was identified by its interaction with the catalytic domain of protein kinase C-zeta. The encoded protein contains an actin-binding site and an ATP-binding site. It is most closely related to twinfilin (PTK9), a conserved actin monomer-binding protein. [provided by RefSeq, Jul 2008]

Uniprot Description

A6r: Actin-binding protein involved in motile and morphological processes. Inhibits actin polymerization, likely by sequestering G-actin. By capping the barbed ends of filaments, it also regulates motility. Seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles. May play a role in regulating the mature length of the middle and short rows of stereocilia. Belongs to the actin-binding proteins ADF family. Twinfilin subfamily.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: stereocilium; cytoskeleton; growth cone; myofibril; perinuclear region of cytoplasm; lamellipodium; cytoplasm; filopodium

Molecular Function: actin monomer binding; phosphatidylinositol-4,5-bisphosphate binding; protein kinase C binding; ATP binding

Biological Process: cell projection organization and biogenesis; negative regulation of actin filament polymerization; sequestering of actin monomers; regulation of actin cytoskeleton organization and biogenesis; positive regulation of axon extension; regulation of microvillus length; barbed-end actin filament capping

Research Articles on TWF2

Similar Products

Product Notes

The TWF2 twf2 (Catalog #AAA644407) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PTK9L (TWF2, PTK9L, Twinfilin-2, A6-related Protein, Protein Tyrosine Kinase 9-like, Twinfilin-1-like Protein) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTK9L can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the TWF2 twf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FAGYQKHLSS CAAPAPLTSA ERELQQIRIN EVKTEISVES KHQTLQGLAF PLQPEAQRAL QQLKQKMVNY IQMKLDLERE TIELVHTEPT DVAQLPSRVP. It is sometimes possible for the material contained within the vial of "PTK9L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.