Mouse anti-Human BRD2 Monoclonal Antibody | anti-BRD2 antibody

BRD2 (Bromodomain-containing Protein 2, Really Interesting New Gene 3 Protein, O27.1.1, KIAA9001, RING3) (FITC)

Cat. Num. AAA6146155

• Gene Names: BRD2; FSH; NAT; RNF3; FSRG1; RING3; D6S113E; O27.1.1; BRD2-IT1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BRD2; Monoclonal Antibody; BRD2 (Bromodomain-containing Protein 2; Really Interesting New Gene 3 Protein; O27.1.1; KIAA9001; RING3) (FITC); anti-BRD2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3D10
• Specificity: Recognizes human BRD2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-BRD2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa167-256, from human BRD2 (NP_005095) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(BRD2 monoclonal antibody Western Blot analysis of BRD2 expression in Hela NE.)

Testing Data

(Detection limit for recombinant GST tagged BRD2 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-BRD2 antibody

BRD2 is a mitogen-activated kinase which localizes to the nucleus. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3 but sequence comparison suggests that the protein is not involved in the immune response. Homology to the Drosophila gene female sterile homeotic suggests that this human protein may be part of a signal transduction pathway involved in growth control.

Product Categories/Family for anti-BRD2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4826806
• NCBI GeneID: 6046
• NCBI Accession #: NP_005095
• NCBI GenBank Nucleotide #: NM_005104
• UniProt Accession #: P25440; O00699; O00700; Q15310; Q5STC9; Q63HQ9; Q658Y7; Q6P3U2; Q969U4; A2AAU0; B0S7P0; B1AZT1
• Molecular Weight: 52.8kDa (478aa)
• NCBI Official Full Name: bromodomain-containing protein 2 isoform 1
• NCBI Official Synonym Full Names: bromodomain containing 2
• NCBI Official Symbol: BRD2
• NCBI Official Synonym Symbols: FSH; NAT; RNF3; FSRG1; RING3; D6S113E; O27.1.1; BRD2-IT1
• NCBI Protein Information: bromodomain-containing protein 2
• UniProt Protein Name: Bromodomain-containing protein 2
• Protein Family: Bromodomain-containing protein
• UniProt Gene Name: BRD2
• UniProt Synonym Gene Names: KIAA9001; RING3
• UniProt Entry Name: BRD2_HUMAN

NCBI Description

This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene. [provided by RefSeq, Dec 2010]