Mouse anti-Human EMP3 Monoclonal Antibody | anti-EMP3 antibody

EMP3 (Epithelial Membrane Protein 3, YMP, EMP-3, Hematopoietic Neural Membrane Protein 1, HNMP-1, Protein YMP) (AP)

Cat. Num. AAA6131116

• Gene Names: EMP3; YMP
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EMP3; Monoclonal Antibody; EMP3 (Epithelial Membrane Protein 3; YMP; EMP-3; Hematopoietic Neural Membrane Protein 1; HNMP-1; Protein YMP) (AP); anti-EMP3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3D4
• Specificity: Recognizes human EMP3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-EMP3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-163 from human EMP3 (AAH09718) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (43.67kD).)

Western Blot (WB)

(EMP3 monoclonal antibody, Western Blot analysis of EMP3 expression in C32.)

Western Blot (WB)

(Western Blot analysis of EMP3 expression in transfected 293T cell line by EMP3 monoclonal antibody. Lane 1: EMP3 transfected lysate (18.429kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EMP3 on formalin-fixed paraffin-embedded human lymphoma tissue. [antibody concentration 3ug/ml].)

Product Categories/Family for anti-EMP3 antibody

Antibodies; Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 16307259
• NCBI GeneID: 2014
• Molecular Weight: 18,429 Da
• NCBI Official Full Name: Homo sapiens epithelial membrane protein 3, mRNA
• NCBI Official Synonym Full Names: epithelial membrane protein 3
• NCBI Official Symbol: EMP3
• NCBI Official Synonym Symbols: YMP
• NCBI Protein Information: epithelial membrane protein 3
• Protein Family: Epithelial membrane protein

NCBI Description

The protein encoded by this gene belongs to the PMP-22/EMP/MP20 family of proteins. The protein contains four transmembrane domains and two N-linked glycosylation sites. It is thought to be involved in cell proliferation, cell-cell interactions and function as a tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]