Mouse anti-Human ELA1 Monoclonal Antibody | anti-ELA1 antibody

ELA1 (Chymotrypsin-like Elastase Family Member 1, Elastase-1, Pancreatic Elastase 1, CELA1) (FITC)

Cat. Num. AAA6147009

• Gene Names: CELA1; ELA1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ELA1; Monoclonal Antibody; ELA1 (Chymotrypsin-like Elastase Family Member 1; Elastase-1; Pancreatic Elastase 1; CELA1) (FITC); anti-ELA1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H5
• Specificity: Recognizes human ELA1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ELA1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa159-257 from human ELA1 (NP_001962) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIAS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ELA1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ELA1 is 3ng/ml as a capture antibody.)

Product Categories/Family for anti-ELA1 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 58331209
• NCBI GeneID: 1990
• NCBI Accession #: NP_001962.3
• NCBI GenBank Nucleotide #: NM_001971
• UniProt Accession #: Q9UNI1; Q5MLF0; Q6DJT0; Q6ISM6
• Molecular Weight: 27,798 Da
• NCBI Official Full Name: chymotrypsin-like elastase family member 1
• NCBI Official Synonym Full Names: chymotrypsin-like elastase family, member 1
• NCBI Official Symbol: CELA1
• NCBI Official Synonym Symbols: ELA1
• NCBI Protein Information: chymotrypsin-like elastase family member 1; elastase-1; pancreatic elastase 1; elastase 1, pancreatic
• UniProt Protein Name: Chymotrypsin-like elastase family member 1
• Protein Family: Elongin
• UniProt Gene Name: CELA1
• UniProt Synonym Gene Names: ELA1
• UniProt Entry Name: CELA1_HUMAN

NCBI Description

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas or fecal material is actually referring to chymotrypsin-like elastase family, member 3B. [provided by RefSeq, May 2009]

Uniprot Description

CELA1: Acts upon elastin. Belongs to the peptidase S1 family. Elastase subfamily.

Protein type: Protease; Secreted; Secreted, signal peptide; EC 3.4.21.36

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: extracellular region

Molecular Function: metal ion binding; serine-type endopeptidase activity

Biological Process: Wnt receptor signaling pathway; multicellular organism growth; regulation of cell differentiation; exocrine pancreas development; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; proteolysis; inflammatory response; regulation of cell proliferation; post-embryonic development