Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human ELA1 Monoclonal Antibody | anti-ELA1 antibody

ELA1 (Chymotrypsin-like Elastase Family Member 1, Elastase-1, Pancreatic Elastase 1, CELA1) (AP)

Gene Names
CELA1; ELA1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ELA1; Monoclonal Antibody; ELA1 (Chymotrypsin-like Elastase Family Member 1; Elastase-1; Pancreatic Elastase 1; CELA1) (AP); anti-ELA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H5
Specificity
Recognizes human ELA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ELA1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa159-257 from human ELA1 (NP_001962) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIAS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ELA1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ELA1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ELA1 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ELA1 is 3ng/ml as a capture antibody.)
Product Categories/Family for anti-ELA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,798 Da
NCBI Official Full Name
chymotrypsin-like elastase family member 1
NCBI Official Synonym Full Names
chymotrypsin-like elastase family, member 1
NCBI Official Symbol
CELA1
NCBI Official Synonym Symbols
ELA1
NCBI Protein Information
chymotrypsin-like elastase family member 1; elastase-1; pancreatic elastase 1; elastase 1, pancreatic
UniProt Protein Name
Chymotrypsin-like elastase family member 1
Protein Family
UniProt Gene Name
CELA1
UniProt Synonym Gene Names
ELA1
UniProt Entry Name
CELA1_HUMAN

NCBI Description

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas or fecal material is actually referring to chymotrypsin-like elastase family, member 3B. [provided by RefSeq, May 2009]

Uniprot Description

CELA1: Acts upon elastin. Belongs to the peptidase S1 family. Elastase subfamily.

Protein type: Protease; Secreted; Secreted, signal peptide; EC 3.4.21.36

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: extracellular region

Molecular Function: metal ion binding; serine-type endopeptidase activity

Biological Process: Wnt receptor signaling pathway; multicellular organism growth; regulation of cell differentiation; exocrine pancreas development; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; proteolysis; inflammatory response; regulation of cell proliferation; post-embryonic development

Research Articles on ELA1

Similar Products

Product Notes

The ELA1 cela1 (Catalog #AAA6131100) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ELA1 (Chymotrypsin-like Elastase Family Member 1, Elastase-1, Pancreatic Elastase 1, CELA1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ELA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ELA1 cela1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ELA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.