Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged EIF5B is 0.1ng/ml as a capture antibody.)

Mouse anti-Human EIF5B Monoclonal Antibody | anti-EIF5B antibody

EIF5B (Eukaryotic Translation Initiation Factor 5B, eIF-5B, Translation Initiation Factor IF-2, IF2, KIAA0741, DKFZp434I036, eIF-5B, FLJ10524) APC

Gene Names
EIF5B; IF2
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EIF5B; Monoclonal Antibody; EIF5B (Eukaryotic Translation Initiation Factor 5B; eIF-5B; Translation Initiation Factor IF-2; IF2; KIAA0741; DKFZp434I036; FLJ10524) APC; anti-EIF5B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F9
Specificity
Recognizes human EIF5B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-EIF5B antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1121-1218 from EIF5B (NP_056988) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged EIF5B is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EIF5B is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-EIF5B antibody
Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2.
Product Categories/Family for anti-EIF5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
139kDa
NCBI Official Full Name
eukaryotic translation initiation factor 5B
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 5B
NCBI Official Symbol
EIF5B
NCBI Official Synonym Symbols
IF2
NCBI Protein Information
eukaryotic translation initiation factor 5B
UniProt Protein Name
Eukaryotic translation initiation factor 5B
UniProt Gene Name
EIF5B
UniProt Synonym Gene Names
IF2; KIAA0741; eIF-5B
UniProt Entry Name
IF2P_HUMAN

NCBI Description

Accurate initiation of translation in eukaryotes is complex and requires many factors, some of which are composed of multiple subunits. The process is simpler in prokaryotes which have only three initiation factors (IF1, IF2, IF3). Two of these factors are conserved in eukaryotes: the homolog of IF1 is eIF1A and the homolog of IF2 is eIF5B. This gene encodes eIF5B. Factors eIF1A and eIF5B interact on the ribosome along with other initiation factors and GTP to position the initiation methionine tRNA on the start codon of the mRNA so that translation initiates accurately. [provided by RefSeq, Jul 2008]

Uniprot Description

EIF5B: Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2. Belongs to the IF-2 family.

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 2q11.2

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: GTPase activity; protein binding; GTP binding; translation initiation factor activity

Biological Process: cellular protein metabolic process; translation; translational initiation; gene expression; regulation of translational initiation

Research Articles on EIF5B

Similar Products

Product Notes

The EIF5B eif5b (Catalog #AAA6136402) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EIF5B (Eukaryotic Translation Initiation Factor 5B, eIF-5B, Translation Initiation Factor IF-2, IF2, KIAA0741, DKFZp434I036, eIF-5B, FLJ10524) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EIF5B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EIF5B eif5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EIF5B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.