Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of WBSCR1 expression in transfected 293T cell line by WBSCR1 monoclonal antibody. Lane 1: WBSCR1 transfected lysate (27.4kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human EIF4H Monoclonal Antibody | anti-EIF4H antibody

EIF4H (KIAA0038, WBSCR1, WSCR1, Eukaryotic Translation Initiation Factor 4H, eIF-4H, Williams-Beuren Syndrome Chromosomal Region 1 Protein) (AP)

Gene Names
EIF4H; WSCR1; WBSCR1; eIF-4H
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EIF4H; Monoclonal Antibody; EIF4H (KIAA0038; WBSCR1; WSCR1; Eukaryotic Translation Initiation Factor 4H; eIF-4H; Williams-Beuren Syndrome Chromosomal Region 1 Protein) (AP); anti-EIF4H antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B2
Specificity
Recognizes human WBSCR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EIF4H antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human WBSCR1 (NP_114381) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of WBSCR1 expression in transfected 293T cell line by WBSCR1 monoclonal antibody. Lane 1: WBSCR1 transfected lysate (27.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of WBSCR1 expression in transfected 293T cell line by WBSCR1 monoclonal antibody. Lane 1: WBSCR1 transfected lysate (27.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Detection limit for recombinant GST tagged WBSCR1 is ~3ng/ml as a capture antibody.)

Western Blot (WB) (Detection limit for recombinant GST tagged WBSCR1 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-EIF4H antibody
This gene encodes one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants.
Product Categories/Family for anti-EIF4H antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.9 kDa
NCBI Official Full Name
eukaryotic translation initiation factor 4H isoform 2
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4H
NCBI Official Symbol
EIF4H
NCBI Official Synonym Symbols
WSCR1; WBSCR1; eIF-4H
NCBI Protein Information
eukaryotic translation initiation factor 4H
UniProt Protein Name
Eukaryotic translation initiation factor 4H
UniProt Gene Name
EIF4H
UniProt Synonym Gene Names
KIAA0038; WBSCR1; WSCR1; eIF-4H
UniProt Entry Name
IF4H_HUMAN

Uniprot Description

EIF4H: eukaryotic translation initiation factor 4H stimulates protein translation. May stimulate the activities of EIF4A, EIF4B and EIF4F during the steps involving mRNA binding and utilization in the initiation of protein biosynthesis. Binds mRNA. Two alternatively spliced isoforms have been described. The short isoform is the predominant isoform and is expressed alone in liver and skeletal muscle. Both isoforms are expressed in fibroblast, spleen, testis and bone marrow. Levels are high in lung and pancreas and low in heart, frontal cortex and kidney.

Protein type: Translation; RNA-binding; Translation initiation

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: membrane; perinuclear region of cytoplasm; eukaryotic translation initiation factor 4F complex; cytosol

Molecular Function: protein binding; translation factor activity, nucleic acid binding; RNA binding; translation initiation factor activity; nucleotide binding

Biological Process: developmental growth; cellular protein metabolic process; translation; viral reproduction; sexual reproduction; translational initiation; gene expression; regulation of translational initiation

Disease: Williams-beuren Syndrome

Similar Products

Product Notes

The EIF4H eif4h (Catalog #AAA6131095) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EIF4H (KIAA0038, WBSCR1, WSCR1, Eukaryotic Translation Initiation Factor 4H, eIF-4H, Williams-Beuren Syndrome Chromosomal Region 1 Protein) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EIF4H can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EIF4H eif4h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EIF4H, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.