Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.34kD).)

Mouse anti-Human EIF4EBP2 Monoclonal Antibody | anti-EIF4EBP2 antibody

EIF4EBP2 (Eukaryotic Translation Initiation Factor 4E-binding Protein 2, 4E-BP2, eIF4E-binding Protein 2) (PE)

Gene Names
EIF4EBP2; 4EBP2; PHASII
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EIF4EBP2; Monoclonal Antibody; EIF4EBP2 (Eukaryotic Translation Initiation Factor 4E-binding Protein 2; 4E-BP2; eIF4E-binding Protein 2) (PE); anti-EIF4EBP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G8
Specificity
Recognizes human EIF4EBP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-EIF4EBP2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa61-120 from human EIF4EBP2 (NP_004087) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.34kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.34kD).)
Related Product Information for anti-EIF4EBP2 antibody
This protein regulates eIF4E activity by preventing its assembly into the eIF4F complex. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase pathway. Nonphosphorylated EIF4EBP2 interacts with EIF4E. Phosphorylated on serine and threonine residues in response to insulin, EGF and PDGF. Belongs to the eIF4E binding protein family.
Product Categories/Family for anti-EIF4EBP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.1 kDa (140aa) confirmed by MALDI-TOF
NCBI Official Full Name
eukaryotic translation initiation factor 4E-binding protein 2
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4E binding protein 2
NCBI Official Symbol
EIF4EBP2
NCBI Official Synonym Symbols
4EBP2; PHASII
NCBI Protein Information
eukaryotic translation initiation factor 4E-binding protein 2
UniProt Protein Name
Eukaryotic translation initiation factor 4E-binding protein 2
UniProt Gene Name
EIF4EBP2
UniProt Synonym Gene Names
4E-BP2; eIF4E-binding protein 2
UniProt Entry Name
4EBP2_HUMAN

NCBI Description

This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq, Oct 2008]

Uniprot Description

4E-BP2: eukaryotic translation initiation factor 4E binding protein 2

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 10q21-q22

Molecular Function: protein binding; eukaryotic initiation factor 4E binding

Biological Process: negative regulation of translational initiation; cAMP-mediated signaling; translation; insulin receptor signaling pathway

Research Articles on EIF4EBP2

Similar Products

Product Notes

The EIF4EBP2 eif4ebp2 (Catalog #AAA6157605) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EIF4EBP2 (Eukaryotic Translation Initiation Factor 4E-binding Protein 2, 4E-BP2, eIF4E-binding Protein 2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EIF4EBP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EIF4EBP2 eif4ebp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EIF4EBP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.