Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200187_WB10.jpg WB (Western Blot) (WB Suggested Anti-COPA Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateCOPA is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Rabbit COPA Polyclonal Antibody | anti-COPA antibody

COPA antibody - N-terminal region

Gene Names
COPA; AILJK; HEP-COP; alpha-COP
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COPA, Antibody; COPA antibody - N-terminal region; anti-COPA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD
Sequence Length
1224
Applicable Applications for anti-COPA antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human COPA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-COPA Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateCOPA is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

product-image-AAA200187_WB10.jpg WB (Western Blot) (WB Suggested Anti-COPA Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateCOPA is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

WB (Western Blot)

(Host: RabbitTarget Name: COPASample Type: Hela Whole Cell lysatesAntibody Dilution: 3ug/ml)

product-image-AAA200187_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: COPASample Type: Hela Whole Cell lysatesAntibody Dilution: 3ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: COPASample Type: Hela Whole Cell lysatesAntibody Dilution: 3.0ug/ml)

product-image-AAA200187_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: COPASample Type: Hela Whole Cell lysatesAntibody Dilution: 3.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: COPASample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)

product-image-AAA200187_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: COPASample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-COPA antibody
This is a rabbit polyclonal antibody against COPA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). Seven coat proteins have been identified, and they represent subunits of a complex known as coatomer. The subunits are designated alpha-COP, beta-COP, beta-prime-COP, gamma-COP, delta-COP, epsilon-COP, and zeta-COP. The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone.In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). Seven coat proteins have been identified, and they represent subunits of a complex known as coatomer. The subunits are designated alpha-COP, beta-COP, beta-prime-COP, gamma-COP, delta-COP, epsilon-COP, and zeta-COP. The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone. Alternative splicing results in multiple splice forms encoding distinct isoforms.
Product Categories/Family for anti-COPA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
135kDa
NCBI Official Full Name
coatomer subunit alpha isoform 2
NCBI Official Synonym Full Names
coatomer protein complex subunit alpha
NCBI Official Symbol
COPA
NCBI Official Synonym Symbols
AILJK; HEP-COP; alpha-COP
NCBI Protein Information
coatomer subunit alpha
UniProt Protein Name
Coatomer subunit alpha
UniProt Gene Name
COPA
UniProt Synonym Gene Names
Alpha-COP; HEPCOP
UniProt Entry Name
COPA_HUMAN

Similar Products

Product Notes

The COPA copa (Catalog #AAA200187) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COPA antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's COPA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the COPA copa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PWILTSLHNG VIQLWDYRMC TLIDKFDEHD GPVRGIDFHK QQPLFVSGGD. It is sometimes possible for the material contained within the vial of "COPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.