Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged EDG1 is approximately 0.3ng/ml as a capture antibody.)

Mouse EDG1 Monoclonal Antibody | anti-EDG1 antibody

EDG1 (Sphingosine-1-Phosphate Receptor 1, CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, FLJ58121, S1P1) (Biotin)

Gene Names
S1PR1; EDG1; S1P1; CD363; ECGF1; EDG-1; CHEDG1; D1S3362
Applications
Western Blot
Purity
Purified
Synonyms
EDG1; Monoclonal Antibody; EDG1 (Sphingosine-1-Phosphate Receptor 1; CHEDG1; D1S3362; ECGF1; EDG-1; FLJ58121; S1P1) (Biotin); Sphingosine-1-Phosphate Receptor 1; S1P1; anti-EDG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1F11
Specificity
Recognizes EDG1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
382
Applicable Applications for anti-EDG1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EDG1 (AAH18650, 1aa-47aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL
Conjugate
Biotin
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged EDG1 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EDG1 is approximately 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of EDG1 expression in transfected 293T cell line by EDG1 monoclonal antibody (M03), clone 1F11.Lane 1: EDG1 transfected lysate (42.8 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EDG1 expression in transfected 293T cell line by EDG1 monoclonal antibody (M03), clone 1F11.Lane 1: EDG1 transfected lysate (42.8 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-EDG1 antibody
The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq]
Product Categories/Family for anti-EDG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Sphingosine-1-phosphate receptor 1
NCBI Official Synonym Full Names
sphingosine-1-phosphate receptor 1
NCBI Official Symbol
S1PR1
NCBI Official Synonym Symbols
EDG1; S1P1; CD363; ECGF1; EDG-1; CHEDG1; D1S3362
NCBI Protein Information
sphingosine 1-phosphate receptor 1

NCBI Description

The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Research Articles on EDG1

Similar Products

Product Notes

The EDG1 (Catalog #AAA6172713) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EDG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EDG1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EDG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.