Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human EDEM1 Monoclonal Antibody | anti-EDEM1 antibody

EDEM1 (ER Degradation-enhancing alpha-mannosidase-like Protein 1, EDEM, KIAA0212) (FITC)

Gene Names
EDEM1; EDEM
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EDEM1; Monoclonal Antibody; EDEM1 (ER Degradation-enhancing alpha-mannosidase-like Protein 1; EDEM; KIAA0212) (FITC); anti-EDEM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D3
Specificity
Recognizes human EDEM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
6113
Applicable Applications for anti-EDEM1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa559-656 from EDEM1 (NP_055489) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Testing Data

(Detection limit for recombinant GST tagged EDEM1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EDEM1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-EDEM1 antibody
Extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-independent manner, probably by forming a complex with SEL1L. It lacks mannosidase activity.
Product Categories/Family for anti-EDEM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ER degradation enhancing alpha-mannosidase like protein 1 (EDEM1), mRNA
NCBI Official Synonym Full Names
ER degradation enhancing alpha-mannosidase like protein 1
NCBI Official Symbol
EDEM1
NCBI Official Synonym Symbols
EDEM
NCBI Protein Information
ER degradation-enhancing alpha-mannosidase-like protein 1
UniProt Protein Name
ER degradation-enhancing alpha-mannosidase-like protein 1
UniProt Gene Name
EDEM1
UniProt Synonym Gene Names
EDEM; KIAA0212

Uniprot Description

EDEM1: Extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-independent manner, probably by forming a complex with SEL1L. It lacks mannosidase activity. Belongs to the glycosyl hydrolase 47 family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p26.1

Cellular Component: endoplasmic reticulum; integral to endoplasmic reticulum membrane

Molecular Function: alpha-mannosidase activity; mannosyl-oligosaccharide 1,2-alpha-mannosidase activity; misfolded protein binding; protein binding

Biological Process: ER-associated protein catabolic process; N-glycan processing; unfolded protein response

Research Articles on EDEM1

Similar Products

Product Notes

The EDEM1 edem1 (Catalog #AAA6146962) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EDEM1 (ER Degradation-enhancing alpha-mannosidase-like Protein 1, EDEM, KIAA0212) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EDEM1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EDEM1 edem1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EDEM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.