Mouse anti-Human EBAG9 Monoclonal Antibody | anti-EBAG9 antibody

EBAG9 (Estrogen Receptor-binding Fragment-associated Gene 9 Protein, EB9, Cancer-associated Surface Antigen RCAS1, PDAF, Receptor-binding Cancer Antigen Expressed on SiSo Cells, RCAS1) (AP)

Cat. Num. AAA6131045

• Gene Names: EBAG9; EB9; PDAF
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EBAG9; Monoclonal Antibody; EBAG9 (Estrogen Receptor-binding Fragment-associated Gene 9 Protein; EB9; Cancer-associated Surface Antigen RCAS1; PDAF; Receptor-binding Cancer Antigen Expressed on SiSo Cells; RCAS1) (AP); anti-EBAG9 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4A10
• Specificity: Recognizes human EBAG9.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-EBAG9 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-214 from EBAG9 (AAH17729) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (49.54kD).)

Western Blot (WB)

(EBAG9 monoclonal antibody Western Blot analysis of EBAG9 expression in MCF-7)

Testing Data

(Detection limit for recombinant GST tagged EBAG9 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-EBAG9 antibody

This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor which binds to the estrogen-responsive element (ERE) found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Two transcript variants differing in the 5' UTR, but encoding the same protein, have been identified for this gene.

Product Categories/Family for anti-EBAG9 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 17389375
• NCBI GeneID: 9166
• Molecular Weight: 29,466 Da
• NCBI Official Full Name: Homo sapiens estrogen receptor binding site associated, antigen, 9, mRNA
• NCBI Official Synonym Full Names: estrogen receptor binding site associated, antigen, 9
• NCBI Official Symbol: EBAG9
• NCBI Official Synonym Symbols: EB9; PDAF
• NCBI Protein Information: receptor-binding cancer antigen expressed on SiSo cells
• Protein Family: Receptor-binding cancer antigen

NCBI Description

This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Alternate splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 10. [provided by RefSeq, Jul 2013]