Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (45.54kD).)

Mouse anti-Human PTTG1IP Monoclonal Antibody | anti-PTTG1IP antibody

PTTG1IP (Pituitary Tumor-transforming Gene 1 Protein-interacting Protein, Pituitary Tumor-transforming Gene Protein-binding Factor, PBF, PTTG-binding Factor, C21orf1, C21orf3) (Biotin)

Gene Names
PTTG1IP; PBF; C21orf1; C21orf3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PTTG1IP; Monoclonal Antibody; PTTG1IP (Pituitary Tumor-transforming Gene 1 Protein-interacting Protein; Pituitary Tumor-transforming Gene Protein-binding Factor; PBF; PTTG-binding Factor; C21orf1; C21orf3) (Biotin); anti-PTTG1IP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C11
Specificity
Recognizes human PTTG1IP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
2604
Applicable Applications for anti-PTTG1IP antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-180 from human PTTG1IP (AAH20983) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (45.54kD).)

Western Blot (WB) (Western Blot detection against Immunogen (45.54kD).)

Western Blot (WB)

(Western Blot analysis of PTTG1IP expression in transfected 293T cell line by PTTG1IP monoclonal antibody. Lane 1: PTTG1IP transfected lysate (20.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PTTG1IP expression in transfected 293T cell line by PTTG1IP monoclonal antibody. Lane 1: PTTG1IP transfected lysate (20.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PTTG1IP antibody
PTTG1IP directly binds to pituitary tumor-transforming gene 1 protein (PTTG1), facilitates the nuclear translocation of PTTG1 and potentiates the transcriptional activation of basic fibroblast growth factor by PTTG1.
Product Categories/Family for anti-PTTG1IP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
754
UniProt Accession #
NCBI Official Full Name
Homo sapiens pituitary tumor-transforming 1 interacting protein, mRNA
NCBI Official Synonym Full Names
PTTG1 interacting protein
NCBI Official Symbol
PTTG1IP
NCBI Official Synonym Symbols
PBF; C21orf1; C21orf3
NCBI Protein Information
pituitary tumor-transforming gene 1 protein-interacting protein
UniProt Protein Name
Pituitary tumor-transforming gene 1 protein-interacting protein
UniProt Gene Name
PTTG1IP
UniProt Synonym Gene Names
C21orf1; C21orf3; PBF
UniProt Entry Name
PTTG_HUMAN

NCBI Description

This gene encodes a single-pass type I integral membrane protein, which binds to pituitary tumor-transforming 1 protein (PTTG1), and facilitates translocation of PTTG1 into the nucleus. Coexpression of this protein and PTTG1 induces transcriptional activation of basic fibroblast growth factor. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2013]

Uniprot Description

PTTG1IP: May facilitate PTTG1 nuclear translocation.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: membrane; cytoplasm; integral to membrane; nucleus

Molecular Function: receptor activity

Biological Process: protein import into nucleus; multicellular organismal development

Research Articles on PTTG1IP

Similar Products

Product Notes

The PTTG1IP pttg1ip (Catalog #AAA6143835) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PTTG1IP (Pituitary Tumor-transforming Gene 1 Protein-interacting Protein, Pituitary Tumor-transforming Gene Protein-binding Factor, PBF, PTTG-binding Factor, C21orf1, C21orf3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTTG1IP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTTG1IP pttg1ip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTTG1IP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.