Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.03kD).)

Mouse anti-Human DYNLL2 Monoclonal Antibody | anti-DYNLL2 antibody

DYNLL2 (Dynein Light Chain 2, Cytoplasmic, 8kD Dynein Light Chain B, DLC8b, Dynein Light Chain LC8-type 2, DLC2, MGC17810) APC

Gene Names
DYNLL2; Dlc2; DNCL1B; RSPH22
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DYNLL2; Monoclonal Antibody; DYNLL2 (Dynein Light Chain 2; Cytoplasmic; 8kD Dynein Light Chain B; DLC8b; Dynein Light Chain LC8-type 2; DLC2; MGC17810) APC; anti-DYNLL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G7
Specificity
Recognizes human DYNLL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-DYNLL2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-73 from human DYNLL2 (NP_542408) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.03kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.03kD).)
Related Product Information for anti-DYNLL2 antibody
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
Product Categories/Family for anti-DYNLL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12.5 kDa (109aa), confirmed by MALDI-TOF
NCBI Official Full Name
dynein light chain 2, cytoplasmic
NCBI Official Synonym Full Names
dynein light chain LC8-type 2
NCBI Official Symbol
DYNLL2
NCBI Official Synonym Symbols
Dlc2; DNCL1B; RSPH22
NCBI Protein Information
dynein light chain 2, cytoplasmic
UniProt Protein Name
Dynein light chain 2, cytoplasmic
Protein Family
UniProt Gene Name
DYNLL2
UniProt Synonym Gene Names
DLC2; DLC8b
UniProt Entry Name
DYL2_HUMAN

Uniprot Description

DYNLL2: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures. Belongs to the dynein light chain family.

Protein type: Microtubule-binding; Motility/polarity/chemotaxis; Motor

Chromosomal Location of Human Ortholog: 17q22

Cellular Component: dynein complex; microtubule; centrosome; membrane; plasma membrane; myosin complex; nucleus; cytosol

Molecular Function: protein binding; cytoskeletal protein binding; motor activity

Biological Process: apoptosis; metabolic process; transport; organelle organization and biogenesis; antigen processing and presentation of exogenous peptide antigen via MHC class II; synaptic target recognition; microtubule-based process

Research Articles on DYNLL2

Similar Products

Product Notes

The DYNLL2 dynll2 (Catalog #AAA6136332) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DYNLL2 (Dynein Light Chain 2, Cytoplasmic, 8kD Dynein Light Chain B, DLC8b, Dynein Light Chain LC8-type 2, DLC2, MGC17810) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DYNLL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DYNLL2 dynll2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DYNLL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.