Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HXD13 antibody Titration: 1 ug/mLSample Type: Human Fetal Liver)

Rabbit anti-Human HOXD13 Polyclonal Antibody | anti-HOXD13 antibody

HOXD13 Antibody - N-terminal region

Gene Names
HOXD13; BDE; SPD; BDSD; SPD1; HOX4I
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HOXD13; Polyclonal Antibody; HOXD13 Antibody - N-terminal region; anti-HOXD13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASGFAYPGTSERTGSSSSSSSSAVVAARPEAPPAKECPAPTPAAAAAAPP
Sequence Length
343
Applicable Applications for anti-HOXD13 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-HOXD13 antibody is: synthetic peptide directed towards the N-terminal region of Human HXD13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HXD13 antibody Titration: 1 ug/mLSample Type: Human Fetal Liver)

Western Blot (WB) (WB Suggested Anti-HXD13 antibody Titration: 1 ug/mLSample Type: Human Fetal Liver)
Related Product Information for anti-HOXD13 antibody
This is a rabbit polyclonal antibody against HXD13. It was validated on Western Blot

Target Description: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. Mutations in this particular gene cause synpolydactyly.
Product Categories/Family for anti-HOXD13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
homeobox protein Hox-D13
NCBI Official Synonym Full Names
homeobox D13
NCBI Official Symbol
HOXD13
NCBI Official Synonym Symbols
BDE; SPD; BDSD; SPD1; HOX4I
NCBI Protein Information
homeobox protein Hox-D13
UniProt Protein Name
Homeobox protein Hox-D13
Protein Family
UniProt Gene Name
HOXD13
UniProt Synonym Gene Names
HOX4I
UniProt Entry Name
HXD13_HUMAN

NCBI Description

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. Mutations in this particular gene cause synpolydactyly. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXD13: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Defects in HOXD13 are the cause of synpolydactyly 1 (SPD1); also known as syndactyly type 2 (SDTY2). SPD1 is a limb malformation that shows a characteristic manifestation in both hands and feet. This condition is inherited as an autosomal dominant trait with reduced penetrance. Defects in HOXD13 are the cause of brachydactyly type D (BDD). BDD is characterized by short and broad terminal phalanges of the thumbs and big toes. Inheritance is autosomal dominant. Defects in HOXD13 are the cause of syndactyly type 5 (SDTY5); also known as syndactyly with metacarpal and metatarsal fusion. The metacarpals and metatarsals most commonly fused are the 4th and 5th or the 3rd and 4th. Soft tissue syndactyly usually affects the 3rd and 4th fingers and the 2nd and 3rd toes. Inheritance is autosomal dominant. Defects in HOXD13 are the cause of brachydactyly- syndactyly syndrome (BDSD). Most of affected individuals exhibit generalized shortening of the hands and feet, broad and short distal phalanges of the thumbs, and cutaneous syndactyly of toes 2 and 3. The limb phenotypes observed in this syndrome overlap those of brachydactyly types A4, D, E and syndactyly type 1. Defects in HOXD13 are the cause of brachydactyly type E (BDE1). BDE is characterized by shortening of the fingers mainly in the metacarpals and metatarsals. Inheritance is autosomal dominant. Defects in HOXD13 are a cause of VACTERL association (VACTERL); which includes also VATER association. VACTERL is an acronym for vertebral anomalies, anal atresia, congenital cardiac disease, tracheoesophageal fistula, renal anomalies, radial dysplasia, and other limb defects. Belongs to the Abd-B homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: nucleus

Molecular Function: DNA binding; sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: anterior/posterior pattern formation; transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; multicellular organismal development; male genitalia development; positive regulation of transcription from RNA polymerase II promoter; embryonic digit morphogenesis; skeletal development; regulation of cell proliferation; embryonic hindgut morphogenesis

Disease: Synpolydactyly 1; Brachydactyly-syndactyly Syndrome; Brachydactyly, Type E1; Syndactyly, Type V; Brachydactyly, Type D; Vater Association

Research Articles on HOXD13

Similar Products

Product Notes

The HOXD13 hoxd13 (Catalog #AAA3220297) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXD13 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXD13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HOXD13 hoxd13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASGFAYPGTS ERTGSSSSSS SSAVVAARPE APPAKECPAP TPAAAAAAPP. It is sometimes possible for the material contained within the vial of "HOXD13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.