Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Sulfotransferase 1A1 (SULT1A1), partial Recombinant Protein | SULT1A1 recombinant protein

Recombinant Human Sulfotransferase 1A1 (SULT1A1), partial

Gene Names
SULT1A1; PST; STP; STP1; P-PST; ST1A1; ST1A3; TSPST1; HAST1/HAST2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sulfotransferase 1A1 (SULT1A1); partial; Recombinant Human Sulfotransferase 1A1 (SULT1A1); Sulfotransferase 1A1; ST1A1; EC=2.8.2.1; Aryl sulfotransferase 1; HAST1/HAST2; Phenol sulfotransferase 1; Phenol-sulfating phenol sulfotransferase 1; P-PST 1; ST1A3; Thermostable phenol sulfotransferase; Ts-PST; SULT1A1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-295aa; Full Length of BC000923
Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for SULT1A1 recombinant protein
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.
Product Categories/Family for SULT1A1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61.1 kDa
NCBI Official Full Name
sulfotransferase 1A1 isoform a
NCBI Official Synonym Full Names
sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1
NCBI Official Symbol
SULT1A1
NCBI Official Synonym Symbols
PST; STP; STP1; P-PST; ST1A1; ST1A3; TSPST1; HAST1/HAST2
NCBI Protein Information
sulfotransferase 1A1; ts-PST; P-PST 1; aryl sulfotransferase 1; thermostable phenol sulfotransferase1; phenol-sulfating phenol sulfotransferase 1
UniProt Protein Name
Sulfotransferase 1A1
Protein Family
UniProt Gene Name
SULT1A1
UniProt Synonym Gene Names
STP; STP1; ST1A1; P-PST 1; Ts-PST
UniProt Entry Name
ST1A1_HUMAN

NCBI Description

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SULT1A1: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N- hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. Belongs to the sulfotransferase 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Energy Metabolism - sulfur; EC 2.8.2.1; Transferase

Chromosomal Location of Human Ortholog: 16p12.1

Cellular Component: cytosol

Molecular Function: sulfotransferase activity; steroid sulfotransferase activity; flavonol 3-sulfotransferase activity; aryl sulfotransferase activity

Biological Process: estrogen metabolic process; flavonoid metabolic process; xenobiotic metabolic process; sulfation; catecholamine metabolic process; amine metabolic process; 3'-phosphoadenosine 5'-phosphosulfate metabolic process

Research Articles on SULT1A1

Similar Products

Product Notes

The SULT1A1 sult1a1 (Catalog #AAA963203) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-295aa; Full Length of BC000923. The amino acid sequence is listed below: MELIQDTSRP PLEYVKGVPL IKYFAEALGP LQSFQARPDD LLISTYPKSG TTWVSQILDM IYQGGDLEKC HRAPIFMRVP FLEFKAPGIP SGMETLKDTP APRLLKTHLP LALLPQTLLD QKVKVVYVAR NAKDVAVSYY HFYHMAKVHP EPGTWDSFLE KFMVGEVSYG SWYQHVQEWW ELSRTHPVLY LFYEDMKENP KREIQKILEF VGHSLPEETV DFVVQHTSFK EMKKNPMTNY TTVPQEFMDH SISPFMRKGM AGDWKTTFTV AQNERFDADY AEKMAGCSLS FRSEL. It is sometimes possible for the material contained within the vial of "Sulfotransferase 1A1 (SULT1A1), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.