Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged DUSP16 is 0.3ng/ml as a capture antibody.)

Mouse anti-Human DUSP16 Monoclonal Antibody | anti-DUSP16 antibody

DUSP16 ((Dual Specificity Protein Phosphatase 16, KIAA1700, Mitogen-activated Protein Kinase Phosphatase 7, MAP Kinase Phosphatase 7, MKP7, MKP-7, MGC129701, MGC129702) (HRP)

Gene Names
DUSP16; MKP7; MKP-7
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DUSP16; Monoclonal Antibody; DUSP16 ((Dual Specificity Protein Phosphatase 16; KIAA1700; Mitogen-activated Protein Kinase Phosphatase 7; MAP Kinase Phosphatase 7; MKP7; MKP-7; MGC129701; MGC129702) (HRP); anti-DUSP16 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F3
Specificity
Recognizes human DUSP16.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DUSP16 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa561-666 from human DUSP16 (NP_085143) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSMEIIEVS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DUSP16 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DUSP16 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-DUSP16 antibody
DUSP16 is involved in the inactivation of MAP kinases. The activation of mitogen-activated protein kinase (MAPK) cascades transduces various extracellular signals to the nucleus to induce gene expression, cell proliferation, differentiation, cell cycle arrest, and apoptosis. For full activation of MAPKs, dual-specificity kinases phosphorylate both threonine and tyrosine residues in MAPK TXY motifs. MKPs are dual-specificity phosphatases that dephosphorylate the TXY motif, thereby negatively regulating MAPK activity.
Product Categories/Family for anti-DUSP16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73,102 Da
NCBI Official Full Name
dual specificity protein phosphatase 16
NCBI Official Synonym Full Names
dual specificity phosphatase 16
NCBI Official Symbol
DUSP16
NCBI Official Synonym Symbols
MKP7; MKP-7
NCBI Protein Information
dual specificity protein phosphatase 16; MAPK phosphatase-7; MAP kinase phosphatase 7; mitogen-activated protein kinase phosphatase 7
UniProt Protein Name
Dual specificity protein phosphatase 16
UniProt Gene Name
DUSP16
UniProt Synonym Gene Names
KIAA1700; MKP7; MAP kinase phosphatase 7; MKP-7
UniProt Entry Name
DUS16_HUMAN

NCBI Description

This gene encodes a mitogen-activated protein kinase phosphatase that is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. The encoded protein specifically regulates the c-Jun amino-terminal kinase (JNK) and extracellular signal-regulated kinase (ERK) pathways.[provided by RefSeq, May 2010]

Uniprot Description

MKP-7: a non-receptor, dual-specificity phosphoprotein phosphatase (DUSP). Different members of the DUSP family show distinct substrate specificities for MAPKs, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. DUSP16 suppresses MAPK activation in the order of selectivity, JNK >> p38 > ERK, but interacts with ERK as well as JNK and p38. Overexpression of DUSP16 in BCR-ABL-transformed fibroblasts reduces their transforming capacity in vitro and in vivo via down regulation of BCR-ABL-induced JNK activation. DUSP16 might be haploinsufficient for tumor suppression. Contains 1 rhodanese domain.

Protein type: EC 3.1.3.48; Protein phosphatase, dual-specificity; EC 3.1.3.16

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: nucleoplasm; cytoplasm; cytoplasmic membrane-bound vesicle; nucleus; cytosol

Molecular Function: protein tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity; MAP kinase tyrosine/serine/threonine phosphatase activity; phosphoprotein phosphatase activity

Biological Process: MAPK export from nucleus; dephosphorylation; MAPK phosphatase export from nucleus, leptomycin B sensitive; protein amino acid dephosphorylation; inactivation of MAPK activity

Research Articles on DUSP16

Similar Products

Product Notes

The DUSP16 dusp16 (Catalog #AAA6152230) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DUSP16 ((Dual Specificity Protein Phosphatase 16, KIAA1700, Mitogen-activated Protein Kinase Phosphatase 7, MAP Kinase Phosphatase 7, MKP7, MKP-7, MGC129701, MGC129702) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DUSP16 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DUSP16 dusp16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DUSP16, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.