Western Blot (WB)
(Western blot-MPPED1 Polyclonal Antibody)
Rabbit MPPED1 Polyclonal Antibody | anti-MPPED1 antibody
MPPED1 Polyclonal Antibody
Gene Names
MPPED1; 239AB; FAM1A; C22orf1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
MPPED1; Polyclonal Antibody; MPPED1 Polyclonal Antibody; 239AB; C22orf1; FAM1A; metallophosphoesterase domain containing 1; anti-MPPED1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.55 mg/ml (varies by lot)
Sequence Length
326
Applicable Applications for anti-MPPED1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 277-326 of human MPPED1 (NP_001037835.1).
Immunogen Sequence
PRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS
Positive Samples
U-87MG, Mouse Brain, Rat Brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-MPPED1 Polyclonal Antibody)
Western Blot (WB)
(Western blot-MPPED1 Polyclonal Antibody)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 37kDa; 40kDa
Observed: 37kDa
Observed: 37kDa
NCBI Official Full Name
metallophosphoesterase domain-containing protein 1
NCBI Official Synonym Full Names
metallophosphoesterase domain containing 1
NCBI Official Symbol
MPPED1
NCBI Official Synonym Symbols
239AB; FAM1A; C22orf1
NCBI Protein Information
metallophosphoesterase domain-containing protein 1
UniProt Protein Name
Metallophosphoesterase domain-containing protein 1
Protein Family
UniProt Gene Name
MPPED1
UniProt Synonym Gene Names
C22orf1; FAM1A; 239AB
UniProt Entry Name
MPPD1_HUMAN
Uniprot Description
MPPED1: May have metallophosphoesterase activity (in vitro). Belongs to the UPF0046 family
Chromosomal Location of Human Ortholog: 22q13.31
Molecular Function: hydrolase activity
Biological Process: metabolic process
Research Articles on MPPED1
Similar Products
Product Notes
The MPPED1 mpped1 (Catalog #AAA9140404) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MPPED1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MPPED1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the MPPED1 mpped1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MPPED1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
