Mouse anti-Human DUSP16 Monoclonal Antibody | anti-DUSP16 antibody

DUSP16 ((Dual Specificity Protein Phosphatase 16, KIAA1700, Mitogen-activated Protein Kinase Phosphatase 7, MAP Kinase Phosphatase 7, MKP7, MKP-7, MGC129701, MGC129702) APC

Cat. Num. AAA6136321

• Gene Names: DUSP16; MKP7; MKP-7
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DUSP16; Monoclonal Antibody; DUSP16 ((Dual Specificity Protein Phosphatase 16; KIAA1700; Mitogen-activated Protein Kinase Phosphatase 7; MAP Kinase Phosphatase 7; MKP7; MKP-7; MGC129701; MGC129702) APC; anti-DUSP16 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F3
• Specificity: Recognizes human DUSP16.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-DUSP16 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa561-666 from human DUSP16 (NP_085143) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSMEIIEVS
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DUSP16 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-DUSP16 antibody

DUSP16 is involved in the inactivation of MAP kinases. The activation of mitogen-activated protein kinase (MAPK) cascades transduces various extracellular signals to the nucleus to induce gene expression, cell proliferation, differentiation, cell cycle arrest, and apoptosis. For full activation of MAPKs, dual-specificity kinases phosphorylate both threonine and tyrosine residues in MAPK TXY motifs. MKPs are dual-specificity phosphatases that dephosphorylate the TXY motif, thereby negatively regulating MAPK activity.

Product Categories/Family for anti-DUSP16 antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 38372911
• NCBI GeneID: 80824
• NCBI Accession #: NP_085143.1
• NCBI GenBank Nucleotide #: NM_030640
• UniProt Accession #: Q9BY84; Q547C7; Q9C0G3
• Molecular Weight: 73,102 Da
• NCBI Official Full Name: dual specificity protein phosphatase 16
• NCBI Official Synonym Full Names: dual specificity phosphatase 16
• NCBI Official Symbol: DUSP16
• NCBI Official Synonym Symbols: MKP7; MKP-7
• NCBI Protein Information: dual specificity protein phosphatase 16; MAPK phosphatase-7; MAP kinase phosphatase 7; mitogen-activated protein kinase phosphatase 7
• UniProt Protein Name: Dual specificity protein phosphatase 16
• Protein Family: Dual specificity protein phosphatase
• UniProt Gene Name: DUSP16
• UniProt Synonym Gene Names: KIAA1700; MKP7; MAP kinase phosphatase 7; MKP-7
• UniProt Entry Name: DUS16_HUMAN

NCBI Description

This gene encodes a mitogen-activated protein kinase phosphatase that is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. The encoded protein specifically regulates the c-Jun amino-terminal kinase (JNK) and extracellular signal-regulated kinase (ERK) pathways.[provided by RefSeq, May 2010]

Uniprot Description

MKP-7: a non-receptor, dual-specificity phosphoprotein phosphatase (DUSP). Different members of the DUSP family show distinct substrate specificities for MAPKs, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. DUSP16 suppresses MAPK activation in the order of selectivity, JNK >> p38 > ERK, but interacts with ERK as well as JNK and p38. Overexpression of DUSP16 in BCR-ABL-transformed fibroblasts reduces their transforming capacity in vitro and in vivo via down regulation of BCR-ABL-induced JNK activation. DUSP16 might be haploinsufficient for tumor suppression. Contains 1 rhodanese domain.

Protein type: EC 3.1.3.48; Protein phosphatase, dual-specificity; EC 3.1.3.16

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: nucleoplasm; cytoplasm; cytoplasmic membrane-bound vesicle; nucleus; cytosol

Molecular Function: protein tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity; MAP kinase tyrosine/serine/threonine phosphatase activity; phosphoprotein phosphatase activity

Biological Process: MAPK export from nucleus; dephosphorylation; MAPK phosphatase export from nucleus, leptomycin B sensitive; protein amino acid dephosphorylation; inactivation of MAPK activity