Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human DTX3L Monoclonal Antibody

DTX3L (E3 Ubiquitin-protein Ligase DTX3L, B-lymphoma- and BAL-associated Protein, Protein Deltex-3-like, Rhysin-2, Rhysin2, BBAP)

Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DTX3L; Monoclonal Antibody; DTX3L (E3 Ubiquitin-protein Ligase DTX3L; B-lymphoma- and BAL-associated Protein; Protein Deltex-3-like; Rhysin-2; Rhysin2; BBAP); Anti -DTX3L (E3 Ubiquitin-protein Ligase DTX3L; anti-DTX3L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D10
Specificity
Recognizes human DTX3L.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSERAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAE
Applicable Applications for anti-DTX3L antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml
Immunogen
Partial recombinant protein corresponding to aa3-111 from human DTX3L (NP_612144) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(DTX3L monoclonal antibody, Western Blot analysis of DTX3L expression in A-431.)

Western Blot (WB) (DTX3L monoclonal antibody, Western Blot analysis of DTX3L expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DTX3L on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 6ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to DTX3L on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 6ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DTX3L is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DTX3L is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-DTX3L antibody
Ubiquitin ligase that mediates monoubiquitination of 'Lys-91' of histone H4 (H4K91ub1), in response to DNA damage. Protects cells exposed to DNA-damaging agents. The exact role of H4K91ub1 in DNA damage response is still unclear but it may function as a licensing signal for additional histone H4 post-translational modifications such as H4 'Lys-20' methylation (H4K20me). Involved in the recruitment of 53BP1/TP53BP1 to sites of DNA damage by mediating H4K91ub1 formation.
Product Categories/Family for anti-DTX3L antibody

Similar Products

Product Notes

The DTX3L (Catalog #AAA6006470) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DTX3L (E3 Ubiquitin-protein Ligase DTX3L, B-lymphoma- and BAL-associated Protein, Protein Deltex-3-like, Rhysin-2, Rhysin2, BBAP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DTX3L can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml. Researchers should empirically determine the suitability of the DTX3L for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SHLRPPSPLL VRVYKSGPRV RRKLESYFQS SKSSGGGECT VSTQEHEAPG TFRVEFSERA AKERVLKKGE HQILVDEKPV PIFLVPTENS IKKNTRPQIS SLTQSQAE. It is sometimes possible for the material contained within the vial of "DTX3L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.