Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit Cyclin J Polyclonal Antibody | anti-CCNJ antibody

Cyclin J antibody

Gene Names
CCNJ; bA690P14.1
Applications
Western Blot
Purity
Affinity purified
Synonyms
Cyclin J; Polyclonal Antibody; Cyclin J antibody; Polyclonal Cyclin J; Anti-Cyclin J; bA690P14.1; CCNJ; anti-CCNJ antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Cyclin J antibody was raised against the N terminal of CCNJ
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCNJ antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
371
Applicable Applications for anti-CCNJ antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Cyclin J may be involved in cell division and differentiation.
Cross-Reactivity
Human
Immunogen
Cyclin J antibody was raised using the N terminal of CCNJ corresponding to a region with amino acids FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Cyclin J antibody (MBS5300555) used at 1 ug/ml to detect target protein.)

Related Product Information for anti-CCNJ antibody
Rabbit polyclonal Cyclin J antibody raised against the N terminal of CCNJ
Product Categories/Family for anti-CCNJ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
42 kDa (MW of target protein)
NCBI Official Full Name
cyclin J
NCBI Official Synonym Full Names
cyclin J
NCBI Official Symbol
CCNJ
NCBI Official Synonym Symbols
bA690P14.1
NCBI Protein Information
cyclin-J
UniProt Protein Name
Cyclin-J
Protein Family
UniProt Gene Name
CCNJ
UniProt Entry Name
CCNJ_HUMAN

Uniprot Description

CCNJ: Belongs to the cyclin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 10q23.33

Cellular Component: nucleus

Research Articles on CCNJ

Similar Products

Product Notes

The CCNJ ccnj (Catalog #AAA5300555) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Cyclin J can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CCNJ ccnj for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cyclin J, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual