Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TNFRSF21 is ~3ng/ml as a capture antibody.)

Mouse anti-Human DR6 Monoclonal Antibody | anti-DR6 antibody

DR6 (Death Receptor 6, BM018, MGC31965, TNFR Related Death Receptor 6, Tumor Necrosis Factor Receptor Superfamily Member 21, Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor, TNFRSF21) (Biotin)

Gene Names
TNFRSF21; DR6; CD358; BM-018
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DR6; Monoclonal Antibody; DR6 (Death Receptor 6; BM018; MGC31965; TNFR Related Death Receptor 6; Tumor Necrosis Factor Receptor Superfamily Member 21; Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor; TNFRSF21) (Biotin); anti-DR6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B2
Specificity
Recognizes human TNFRSF21.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-DR6 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-125 from human TNFRSF21 (AAH05192) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQFNFELSFKYVLYSSYSWLKLDHTIADCMVFTWTPCRMLDYLYSSYANMLWAGEMKSSSHQDLLFKWLDNWATKELELHLLGFELFWNTLLHFGKSKSSASGALSIENLPSFALKDVLFFIYT*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TNFRSF21 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TNFRSF21 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-DR6 antibody
Apoptosis is induced by certain cytokines including TNF and Fas ligand of the TNF family through their death domain containing receptors, TNF-R1 and Fas. Several novel death receptors including DR3, DR4, and DR5 were recently identified. A new death domain containing receptor in the TNFR family was cloned recently and termed DR6 for death receptor-6. Like TNF-R1, DR6 interacts with death domain containing adapter molecule TRADD. Overexpression of DR6 induces apoptosis and activates NF-kB and JNK. DR6 is widely expressed in human tissues and cell lines. The ligand for DR6 has not been identified.
Product Categories/Family for anti-DR6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
71,845 Da
NCBI Official Full Name
Homo sapiens tumor necrosis factor receptor superfamily, member 21, mRNA
NCBI Official Synonym Full Names
TNF receptor superfamily member 21
NCBI Official Symbol
TNFRSF21
NCBI Official Synonym Symbols
DR6; CD358; BM-018
NCBI Protein Information
tumor necrosis factor receptor superfamily member 21

NCBI Description

This gene encodes a member of the tumor necrosis factor receptor superfamily. The encoded protein activates nuclear factor kappa-B and mitogen-activated protein kinase 8 (also called c-Jun N-terminal kinase 1), and induces cell apoptosis. Through its death domain, the encoded receptor interacts with tumor necrosis factor receptor type 1-associated death domain (TRADD) protein, which is known to mediate signal transduction of tumor necrosis factor receptors. Knockout studies in mice suggest that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. [provided by RefSeq, Jul 2013]

Research Articles on DR6

Similar Products

Product Notes

The DR6 (Catalog #AAA6141608) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DR6 (Death Receptor 6, BM018, MGC31965, TNFR Related Death Receptor 6, Tumor Necrosis Factor Receptor Superfamily Member 21, Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor, TNFRSF21) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DR6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DR6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DR6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.