Mouse anti-Human, Rat DPH2 Monoclonal Antibody | anti-DPH2 antibody

DPH2 (Diphthamide Biosynthesis Protein 2, DPH2 Homolog, HsDph2, Diphthamide Biosynthesis Protein 2 Homolog-like 2, DPH2-like 2, DPH2L2) (AP)

Cat. Num. AAA6130993

• Gene Names: DPH2; DPH2L2
• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DPH2; Monoclonal Antibody; DPH2 (Diphthamide Biosynthesis Protein 2; DPH2 Homolog; HsDph2; Diphthamide Biosynthesis Protein 2 Homolog-like 2; DPH2-like 2; DPH2L2) (AP); anti-DPH2 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5B10
• Specificity: Recognizes human DPH2. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-DPH2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa125-235 from human DPH2 (NP_001375) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.95kD).)

Western Blot (WB)

(DPH2 monoclonal antibody. Western Blot analysis of DPH2 expression in HeLa.)

Western Blot (WB)

(DPH2 monoclonal antibody. Western Blot analysis of DPH2 expression in PC-12.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DPH2 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DPH2 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-DPH2 antibody

Antibodies; Oncoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 21536476
• NCBI GeneID: 1802
• NCBI Accession #: NP_001375
• NCBI GenBank Nucleotide #: NM_001384
• UniProt Accession #: Q9BQC3; O60623; A8MVC9; B2RDE3; B4DNI8
• Molecular Weight: 53.1kDa (497aa) 50-70kDa (SDS-PAGE under reducing conditions)
• NCBI Official Full Name: 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 isoform a
• NCBI Official Synonym Full Names: DPH2 homolog
• NCBI Official Symbol: DPH2
• NCBI Official Synonym Symbols: DPH2L2
• NCBI Protein Information: 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2; diphthamide biosynthesis protein 2
• UniProt Protein Name: 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2
• Protein Family: 2-(3-amino-3-carboxypropyl)histidine synthase
• UniProt Gene Name: DPH2
• UniProt Synonym Gene Names: DPH2L2

NCBI Description

This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]

Uniprot Description

Required for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2 (EEF2).