Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DPH1 monoclonal antibody. Western Blot analysis of DPH1 expression in HeLa.)

Mouse anti-Human DPH1 Monoclonal Antibody | anti-DPH1 antibody

DPH1 (Diphthamide Biosynthesis Protein 1, DPH2-like 1, DPH2L1, DPH2L, FLJ33211, Ovarian Cancer Associated Gene 1, OVCA1) (Biotin)

Gene Names
DPH1; DPH2L; OVCA1; DEDSSH; DPH2L1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DPH1; Monoclonal Antibody; DPH1 (Diphthamide Biosynthesis Protein 1; DPH2-like 1; DPH2L1; DPH2L; FLJ33211; Ovarian Cancer Associated Gene 1; OVCA1) (Biotin); anti-DPH1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2C5
Specificity
Recognizes human DPH1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-DPH1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa216-324 from DPH1 (NP_001374) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFVRLL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DPH1 monoclonal antibody. Western Blot analysis of DPH1 expression in HeLa.)

Western Blot (WB) (DPH1 monoclonal antibody. Western Blot analysis of DPH1 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DPH1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DPH1 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-DPH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 isoform 1
NCBI Official Synonym Full Names
diphthamide biosynthesis 1
NCBI Official Symbol
DPH1
NCBI Official Synonym Symbols
DPH2L; OVCA1; DEDSSH; DPH2L1
NCBI Protein Information
2-(3-amino-3-carboxypropyl)histidine synthase subunit 1
UniProt Protein Name
Diphthamide biosynthesis protein 1
UniProt Gene Name
DPH1
UniProt Synonym Gene Names
DPH2L; DPH2L1; OVCA1
UniProt Entry Name
DPH1_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme involved in the biosynthesis of diphthamide, a modified histidine found only in elongation factor-2 (EEF2). Diphthamide residues in EEF2 are targeted for ADP-ribosylation by diphtheria toxin and Pseudomonas exotoxin A. Defects in this gene have been associated with both ovarian cancer and autosomal recessive intellectual disability with short stature, craniofacial, and ectodermal anomalies. [provided by RefSeq, Oct 2016]

Research Articles on DPH1

Similar Products

Product Notes

The DPH1 dph1 (Catalog #AAA6141598) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DPH1 (Diphthamide Biosynthesis Protein 1, DPH2-like 1, DPH2L1, DPH2L, FLJ33211, Ovarian Cancer Associated Gene 1, OVCA1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DPH1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DPH1 dph1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DPH1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.