Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DNAJB9 Monoclonal Antibody | anti-DNAJB9 antibody

DNAJB9 (MDG1, DnaJ Homolog Subfamily B Member 9, Microvascular Endothelial Differentiation Gene 1 Protein, DKFZp564F1862) (MaxLight 550)

Gene Names
DNAJB9; MDG1; ERdj4; MDG-1; MST049; MSTP049
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DNAJB9; Monoclonal Antibody; DNAJB9 (MDG1; DnaJ Homolog Subfamily B Member 9; Microvascular Endothelial Differentiation Gene 1 Protein; DKFZp564F1862) (MaxLight 550); anti-DNAJB9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G4
Specificity
Recognizes human DNAJB9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-DNAJB9 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa114-223 from human DNAJB9 (NP_036460.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DNAJB9 antibody
This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70kD heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis.
Product Categories/Family for anti-DNAJB9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
dnaJ homolog subfamily B member 9
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member B9
NCBI Official Symbol
DNAJB9
NCBI Official Synonym Symbols
MDG1; ERdj4; MDG-1; MST049; MSTP049
NCBI Protein Information
dnaJ homolog subfamily B member 9
UniProt Protein Name
DnaJ homolog subfamily B member 9
Protein Family
UniProt Gene Name
DNAJB9
UniProt Synonym Gene Names
MDG1; ER-resident protein ERdj4; ERdj4; Mdg-1
UniProt Entry Name
DNJB9_HUMAN

NCBI Description

This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis. [provided by RefSeq, Dec 2010]

Uniprot Description

DNAJB9: Acts as a co-chaperone with an Hsp70 protein.

Protein type: Chaperone; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 7q31|14q24.2-q24.3

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; endoplasmic reticulum lumen; cytoplasm; nucleolus

Molecular Function: protein binding; misfolded protein binding

Biological Process: ER-associated protein catabolic process; cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; unfolded protein response

Research Articles on DNAJB9

Similar Products

Product Notes

The DNAJB9 dnajb9 (Catalog #AAA6211187) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DNAJB9 (MDG1, DnaJ Homolog Subfamily B Member 9, Microvascular Endothelial Differentiation Gene 1 Protein, DKFZp564F1862) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNAJB9 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DNAJB9 dnajb9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DNAJB9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.