Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Ikaros Picoband antibody, MBS177757, Western blottingAll lanes: Anti Ikaros (MBS177757) at 0.5ug/mlWB: HELA Whole Cell Lysate at 40ugPredicted bind size: 58KDObserved bind size: 58KD )

Ikaros Polyclonal Antibody | anti-IKZF1 antibody

Anti-Ikaros Antibody

Gene Names
IKZF1; IK1; LYF1; LyF-1; CVID13; IKAROS; PPP1R92; PRO0758; ZNFN1A1; Hs.54452
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
Ikaros; Polyclonal Antibody; Anti-Ikaros Antibody; DNA-binding protein Ikaros; CLL associated antigen KW 6; hIk 1; Hs.54452; IK1; Ikaros (zinc finger protein); IKAROS; IKAROS family zinc finger 1 (Ikaros); Ikaros family zinc finger protein 1; Ikzf1; IKZF1_HUMAN; LYF1; Lymphoid transcription factor LyF-1; PRO0758; Zinc finger protein subfamily 1A 1 (Ikaros); Zinc finger protein subfamily 1A 1; Zinc finger protein; subfamily 1A; member 1; ZNFN1A1; anti-IKZF1 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
477
Applicable Applications for anti-IKZF1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Ikaros (428-459aa LKEEHRAYDLLRAASENSQDALRVVSTSGEQM), different from the related mouse sequence by five amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Ikaros Picoband antibody, MBS177757, Western blottingAll lanes: Anti Ikaros (MBS177757) at 0.5ug/mlWB: HELA Whole Cell Lysate at 40ugPredicted bind size: 58KDObserved bind size: 58KD )

Western Blot (WB) (Anti- Ikaros Picoband antibody, MBS177757, Western blottingAll lanes: Anti Ikaros (MBS177757) at 0.5ug/mlWB: HELA Whole Cell Lysate at 40ugPredicted bind size: 58KDObserved bind size: 58KD )

Immunohistochemistry (IHC)

(Anti- Ikaros Picoband antibody, MBS177757, IHC(P)IHC(P): Mouse Spleen Tissue )

Immunohistochemistry (IHC) (Anti- Ikaros Picoband antibody, MBS177757, IHC(P)IHC(P): Mouse Spleen Tissue )

Immunohistochemistry (IHC)

(Anti- Ikaros Picoband antibody, MBS177757, IHC(P)IHC(P): Rat Spleen Tissue )

Immunohistochemistry (IHC) (Anti- Ikaros Picoband antibody, MBS177757, IHC(P)IHC(P): Rat Spleen Tissue )

Immunohistochemistry (IHC)

(Anti- Ikaros Picoband antibody, MBS177757, IHC(P)IHC(P): Human Tonsil Tissue )

Immunohistochemistry (IHC) (Anti- Ikaros Picoband antibody, MBS177757, IHC(P)IHC(P): Human Tonsil Tissue )
Related Product Information for anti-IKZF1 antibody
Description: Rabbit IgG polyclonal antibody for DNA-binding protein Ikaros(IKZF1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.
References
1. Georgopoulos K, Moore DD, Derfler B (December 1992). "Ikaros, an early lymphoid-specific transcription factor and a putative mediator for T cell commitment". Science 258 (5083): 808-12. 2. Hahm K, Ernst P, Lo K, Kim GS, Turck C, Smale ST (November 1994). "The lymphoid transcription factor LyF-1 is encoded by specific, alternatively spliced mRNAs derived from the Ikaros gene". Mol Cell Biol 14 (11): 7111-23.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,470 Da
NCBI Official Full Name
DNA-binding protein Ikaros isoform 2
NCBI Official Synonym Full Names
IKAROS family zinc finger 1
NCBI Official Symbol
IKZF1
NCBI Official Synonym Symbols
IK1; LYF1; LyF-1; CVID13; IKAROS; PPP1R92; PRO0758; ZNFN1A1; Hs.54452
NCBI Protein Information
DNA-binding protein Ikaros
UniProt Protein Name
DNA-binding protein Ikaros
UniProt Gene Name
IKZF1
UniProt Synonym Gene Names
IK1; IKAROS; LYF1; ZNFN1A1
UniProt Entry Name
IKZF1_HUMAN

NCBI Description

This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors. Overexpression of some dominant-negative isoforms have been associated with B-cell malignancies, such as acute lymphoblastic leukemia (ALL). [provided by RefSeq, May 2014]

Uniprot Description

Transcription regulator of hematopoietic cell differentiation (PubMed:17934067). Binds gamma-satellite DNA (PubMed:17135265, PubMed:19141594). Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs) (). Function is isoform-specific and is modulated by dominant-negative inactive isoforms (PubMed:17135265, PubMed:17934067).

Research Articles on IKZF1

Similar Products

Product Notes

The IKZF1 ikzf1 (Catalog #AAA177757) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Ikaros Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Ikaros can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the IKZF1 ikzf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ikaros, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.