Mouse anti-Human DNA Ligase 1 Monoclonal Antibody | anti-DNL1 antibody

DNA Ligase 1 (DNL1, LIG1, DNA Ligase I, Ligase I DNA ATP Dependent, MGC117397, MGC130025, Polydeoxyribonucleotide Synthase [ATP] 1) (HRP)

Cat. Num. AAA6152176

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography
• Synonyms: DNA Ligase 1; Monoclonal Antibody; DNA Ligase 1 (DNL1; LIG1; DNA Ligase I; Ligase I DNA ATP Dependent; MGC117397; MGC130025; Polydeoxyribonucleotide Synthase [ATP] 1) (HRP); anti-DNL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 10G12
• Specificity: Recognizes human LIG1.
• Purity/Purification: Purified by Protein A Affinity Chromatography
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-DNL1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.2ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa810-919 from human LIG1 (NP_000225) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QSLKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDTY
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(LIG1 monoclonal antibody Western Blot analysis of LIG1 expression in HeLa NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LIG1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.2ug/ml])

Testing Data

(Detection limit for recombinant GST tagged LIG1 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-DNL1 antibody

Antibodies; DNA Replication; Repair

NCBI and Uniprot Product Information

• NCBI GI #: 4557719
• NCBI GeneID: 3978
• NCBI Accession #: NP_000225
• NCBI GenBank Nucleotide #: NM_000234
• UniProt Accession #: P18858; Q2TB12; Q32P23; B2RAI8; B4DTU4
• Molecular Weight: 98,228 Da
• NCBI Official Full Name: DNA ligase 1 isoform 1
• NCBI Official Synonym Full Names: ligase I, DNA, ATP-dependent
• NCBI Official Symbol: LIG1
• NCBI Protein Information: DNA ligase 1; polydeoxyribonucleotide synthase [ATP] 1
• UniProt Protein Name: DNA ligase 1
• Protein Family: DNA ligase
• UniProt Gene Name: LIG1
• UniProt Entry Name: DNLI1_HUMAN

Uniprot Description

LIG1: is an enzyme that functions in DNA replication and the base excision repair process. Mutations leading to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents.

Protein type: Ligase; EC 6.5.1.1; DNA repair, damage

Chromosomal Location of Human Ortholog: 19q13.2-q13.3

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle; mitochondrion; chromosome; nucleus

Molecular Function: DNA binding; DNA ligase activity; metal ion binding; DNA ligase (ATP) activity; ATP binding

Biological Process: anatomical structure morphogenesis; mismatch repair; V(D)J recombination; DNA strand elongation during DNA replication; DNA repair; lagging strand elongation; double-strand break repair via homologous recombination; double-strand break repair via nonhomologous end joining; telomere maintenance via semi-conservative replication; response to hydrogen peroxide; base-excision repair; nucleotide-excision repair; cell division; transcription-coupled nucleotide-excision repair; double-strand break repair; telomere maintenance via recombination; DNA ligation during DNA repair; nucleotide-excision repair, DNA gap filling; mitotic cell cycle; telomere maintenance; DNA metabolic process