Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DMBX1 Monoclonal Antibody | anti-DMBX1 antibody

DMBX1 (Diencephalon/Mesencephalon Homeobox Protein 1, Orthodenticle Homolog 3, Paired-like Homeobox Protein DMBX1, MBX, OTX3, PAXB)

Gene Names
DMBX1; MBX; OTX3; PAXB
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DMBX1; Monoclonal Antibody; DMBX1 (Diencephalon/Mesencephalon Homeobox Protein 1; Orthodenticle Homolog 3; Paired-like Homeobox Protein DMBX1; MBX; OTX3; PAXB); Anti -DMBX1 (Diencephalon/Mesencephalon Homeobox Protein 1; anti-DMBX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A9
Specificity
Recognizes human DMBX1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MQHYGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLAGCTFQDIILEARYGSQHRKQRRSRTAFTAQQLEALEK
Applicable Applications for anti-DMBX1 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa1-89 from human DMBX1 (NP_671725) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-DMBX1 antibody
This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. Two transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-DMBX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,198 Da
NCBI Official Full Name
diencephalon/mesencephalon homeobox protein 1 isoform a
NCBI Official Synonym Full Names
diencephalon/mesencephalon homeobox 1
NCBI Official Symbol
DMBX1
NCBI Official Synonym Symbols
MBX; OTX3; PAXB
NCBI Protein Information
diencephalon/mesencephalon homeobox protein 1; homeoprotein MBX; orthodenticle homolog 3; paired-like homeobox protein DMBX1
UniProt Protein Name
Diencephalon/mesencephalon homeobox protein 1
UniProt Gene Name
DMBX1
UniProt Synonym Gene Names
MBX; OTX3; PAXB
UniProt Entry Name
DMBX1_HUMAN

NCBI Description

This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DMBX1: Functions as a transcriptional repressor. May repress OTX2-mediated transactivation by forming a heterodimer with OTX2 on the P3C (5'-TAATCCGATTA-3') sequence. Required for brain development. Belongs to the paired homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 1p33

Cellular Component: transcription factor complex; nucleus

Molecular Function: protein homodimerization activity; DNA binding; protein heterodimerization activity; sequence-specific DNA binding; transcription factor activity

Biological Process: developmental growth; central nervous system development; transcription, DNA-dependent; adult locomotory behavior; adult feeding behavior; negative regulation of transcription from RNA polymerase II promoter; brain development; negative regulation of transcription, DNA-dependent

Research Articles on DMBX1

Similar Products

Product Notes

The DMBX1 dmbx1 (Catalog #AAA6011376) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DMBX1 (Diencephalon/Mesencephalon Homeobox Protein 1, Orthodenticle Homolog 3, Paired-like Homeobox Protein DMBX1, MBX, OTX3, PAXB) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DMBX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the DMBX1 dmbx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQHYGVNGYS LHAMNSLSAM YNLHQQAAQQ AQHAPDYRPS VHALTLAERL AGCTFQDIIL EARYGSQHRK QRRSRTAFTA QQLEALEK. It is sometimes possible for the material contained within the vial of "DMBX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.