Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Mouse anti-Human HUNK Monoclonal Antibody | anti-HUNK antibody
HUNK (Hormonally Up-regulated Neu Tumor-Associated Kinase, B19, MAKV, Serine/threonine-protein Kinase MAK-V) (Biotin)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HUNK; Monoclonal Antibody; HUNK (Hormonally Up-regulated Neu Tumor-Associated Kinase; B19; MAKV; Serine/threonine-protein Kinase MAK-V) (Biotin); anti-HUNK antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2E3
Specificity
Recognizes human HUNK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HUNK antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa615-714 from human HUNK (NP_055401) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Testing Data
(Detection limit for recombinant GST tagged HUNK is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged HUNK is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-HUNK antibody
Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains.
Product Categories/Family for anti-HUNK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79,686 Da
NCBI Official Full Name
hormonally up-regulated neu tumor-associated kinase
NCBI Official Synonym Full Names
hormonally up-regulated Neu-associated kinase
NCBI Official Symbol
HUNK
NCBI Protein Information
hormonally up-regulated neu tumor-associated kinase; B19; hormonally upregulated Neu-associated kinase; hormonally upregulated neu tumor-associated kinase; serine/threonine protein kinase MAK-V; serine/threonine-protein kinase MAK-V
UniProt Protein Name
Hormonally up-regulated neu tumor-associated kinase
Protein Family
UniProt Gene Name
HUNK
UniProt Synonym Gene Names
MAKV
UniProt Entry Name
HUNK_HUMAN
Uniprot Description
HUNK: a protein kinase of the CAMKL family. Is developmentally regulated in a tissue-specific fashion. May contribute to changes in the mammary gland that occur during pregnancy in response to ovarian hormones. The active enzyme is localized in the nucleocytoplasm and the centrosome.
Protein type: Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; CAMK group; CAMKL family; HUNK subfamily
Chromosomal Location of Human Ortholog: 21q22.1
Molecular Function: protein serine/threonine kinase activity; ATP binding
Biological Process: multicellular organismal development; signal transduction; protein amino acid phosphorylation
Similar Products
Product Notes
The HUNK hunk (Catalog #AAA6142389) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HUNK (Hormonally Up-regulated Neu Tumor-Associated Kinase, B19, MAKV, Serine/threonine-protein Kinase MAK-V) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HUNK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HUNK hunk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HUNK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
