Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human DLX4 Monoclonal Antibody | anti-DLX4 antibody

DLX4 (Distal-less Homeobox 4, DII Family Homeodomain Transcription Factor) (AP)

Gene Names
DLX4; BP1; DLX7; DLX8; DLX9
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DLX4; Monoclonal Antibody; DLX4 (Distal-less Homeobox 4; DII Family Homeodomain Transcription Factor) (AP); anti-DLX4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F11
Specificity
Recognizes human DLX4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DLX4 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-98 from human DLX4 (AAH16145) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(Western Blot analysis of DLX4 expression in transfected 293T cell line by DLX4 monoclonal antibody. Lane 1: DLX4 transfected lysate (26kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DLX4 expression in transfected 293T cell line by DLX4 monoclonal antibody. Lane 1: DLX4 transfected lysate (26kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of DLX4 transfected lysate using DLX4 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with DLX4 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of DLX4 transfected lysate using DLX4 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with DLX4 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged DLX4 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DLX4 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of DLX4 over-expressed 293 cell line, cotransfected with DLX4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DLX4 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of DLX4 over-expressed 293 cell line, cotransfected with DLX4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DLX4 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-DLX4 antibody
Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. Three transcript variants have been described for this gene, however, the full length nature of one variant has not been described. Studies of the two splice variants revealed that one encoded isoform functions as a repressor of the beta-globin gene while the other isoform lacks that function.
Product Categories/Family for anti-DLX4 antibody
References
1. Homeodomain protein DLX4 counteracts key transcriptional control mechanisms of the TGF-?] cytostatic program and blocks the antiproliferative effect of TGF-?]. Trinh BQ, Barengo N, Naora H.Oncogene. 2011 Feb 7. 2. A homeobox gene related to Drosophila distal-less promotes ovarian tumorigenicity by inducing expression of vascular endothelial growth factor and fibroblast growth factor-2. Hara F, Samuel S, Liu J, Rosen D, Langley RR, Naora H.Am J Pathol. 2007 May;170(5):1594-606.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
12,713 Da
NCBI Official Full Name
Homo sapiens distal-less homeobox 4, mRNA
NCBI Official Synonym Full Names
distal-less homeobox 4
NCBI Official Symbol
DLX4
NCBI Official Synonym Symbols
BP1; DLX7; DLX8; DLX9
NCBI Protein Information
homeobox protein DLX-4; beta protein 1; distal-less homeo box 7; distal-less homeo box 9; homeobox protein DLX-7; homeobox protein DLX-8
Protein Family

NCBI Description

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. Three transcript variants have been described for this gene, however, the full length nature of one variant has not been described. Studies of the two splice variants revealed that one encoded isoform functions as a repressor of the beta-globin gene while the other isoform lacks that function. [provided by RefSeq, Jul 2008]

Research Articles on DLX4

Similar Products

Product Notes

The DLX4 (Catalog #AAA6130953) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DLX4 (Distal-less Homeobox 4, DII Family Homeodomain Transcription Factor) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DLX4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DLX4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DLX4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.