Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DHX9 Monoclonal Antibody | anti-DHX9 antibody

DHX9 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 9, DEAH Box Protein 9, DHX-9, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9, DDX9, DDX-9, ATP-dependent RNA Helicase A, LKP, Nuclear DNA Helicase II, NDHII, NDH2, RNA Helicase A, RHA) (MaxLight 490)

Gene Names
DHX9; LKP; RHA; DDX9; NDH2; NDHII
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DHX9; Monoclonal Antibody; DHX9 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 9; DEAH Box Protein 9; DHX-9; DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9; DDX9; DDX-9; ATP-dependent RNA Helicase A; LKP; Nuclear DNA Helicase II; NDHII; NDH2; RNA Helicase A; RHA) (MaxLight 490); anti-DHX9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G7
Specificity
Recognizes human DHX9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-DHX9 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
FLISA: The detection limit is ~3ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human DHX9 (NP_001348) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-DHX9 antibody
References
1. Coordinate roles of Gag and RNA helicase A in promoting the annealing of tRNALys3 to HIV-1 RNA. Xing L, Liang C, Kleiman L.J Virol. 2010 Nov 24. 2.Functional proteomic analysis of promyelocytic leukaemia nuclear bodies in irradiation-induced MCF-7 cells. Liu J, Song Y, Tian B, Qian J, Dong Y, Liu J, Liu B, Sun Z.J Biochem. 2010 Dec;148(6):659-67. Epub 2010 Sep 7. 3. RNA Helicase A Interacts with RISC in Human Cells and Functions in RISC Loading. Robb GB, Rana TM.Mol Cell. 2007 May 25;26(4):523-37.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
141kDa
NCBI Official Full Name
ATP-dependent RNA helicase A
NCBI Official Synonym Full Names
DExH-box helicase 9
NCBI Official Symbol
DHX9
NCBI Official Synonym Symbols
LKP; RHA; DDX9; NDH2; NDHII
NCBI Protein Information
ATP-dependent RNA helicase A
UniProt Protein Name
ATP-dependent RNA helicase A
UniProt Gene Name
DHX9
UniProt Synonym Gene Names
DDX9; LKP; NDH2; RHA; LKP; NDH II
UniProt Entry Name
DHX9_HUMAN

NCBI Description

This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 11 and 13.[provided by RefSeq, Feb 2010]

Uniprot Description

DDX9: a helicase that unwinds double-stranded DNA and RNA in a 3' to 5' direction. Interacts with the RNA-induced silencing complex (RISC) in human cells and functions in RISC loading. Generates multiple secondary structures that influence RNA-binding proteins. Has a dsRNA binding motif at the N-terminus, RGG-box at the carboxyl terminus, and a bidirectional nuclear transport domain of 110 amino acids at the carboxyl terminus. May play a role in X-linked gene expression.

Protein type: Nuclear receptor co-regulator; Spliceosome; Nucleolus; Helicase; RNA splicing; EC 3.6.4.13; RNA-binding; RNA processing

Chromosomal Location of Human Ortholog: 1q25

Cellular Component: nucleoplasm; centrosome; membrane; cytoplasm; nucleolus; nucleus; ribonucleoprotein complex; cytosol

Molecular Function: ATP-dependent DNA helicase activity; protein binding; DNA binding; ATP-dependent RNA helicase activity; ATP binding; RNA helicase activity

Biological Process: osteoblast differentiation; circadian rhythm; RNA processing; nuclear mRNA splicing, via spliceosome; RNA splicing; positive regulation of interferon type I production; innate immune response; gene expression; DNA duplex unwinding

Research Articles on DHX9

Similar Products

Product Notes

The DHX9 dhx9 (Catalog #AAA6200471) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DHX9 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 9, DEAH Box Protein 9, DHX-9, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9, DDX9, DDX-9, ATP-dependent RNA Helicase A, LKP, Nuclear DNA Helicase II, NDHII, NDH2, RNA Helicase A, RHA) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHX9 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml FLISA: The detection limit is ~3ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DHX9 dhx9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DHX9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.