Mouse anti-Human DHX9 Monoclonal Antibody | anti-DHX9 antibody

DHX9 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 9, DEAH Box Protein 9, DHX-9, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9, DDX9, DDX-9, ATP-dependent RNA Helicase A, LKP, Nuclear DNA Helicase II, NDHII, NDH2, RNA Helicase A, RHA) (PE)

Cat. Num. AAA6157448

• Gene Names: DHX9; LKP; RHA; DDX9; NDH2; NDHII
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DHX9; Monoclonal Antibody; DHX9 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 9; DEAH Box Protein 9; DHX-9; DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9; DDX9; DDX-9; ATP-dependent RNA Helicase A; LKP; Nuclear DNA Helicase II; NDHII; NDH2; RNA Helicase A; RHA) (PE); anti-DHX9 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G7
• Specificity: Recognizes human DHX9.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-DHX9 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: ELISA: The detection limit is ~3ng/ml as a capture antibody; IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-90 from human DHX9 (NP_001348) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB)

(DHX9 monoclonal antibody Western Blot analysis of DHX9 expression in HeLa NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DHX9 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DHX9 on HeLa cell. [antibody concentration 10ug/ml])

Product Categories/Family for anti-DHX9 antibody

Antibodies; DEAD Box Proteins

References

1. Coordinate roles of Gag and RNA helicase A in promoting the annealing of tRNALys3 to HIV-1 RNA. Xing L, Liang C, Kleiman L.J Virol. 2010 Nov 24. 2.Functional proteomic analysis of promyelocytic leukaemia nuclear bodies in irradiation-induced MCF-7 cells. Liu J, Song Y, Tian B, Qian J, Dong Y, Liu J, Liu B, Sun Z.J Biochem. 2010 Dec;148(6):659-67. Epub 2010 Sep 7. 3. RNA Helicase A Interacts with RISC in Human Cells and Functions in RISC Loading. Robb GB, Rana TM.Mol Cell. 2007 May 25;26(4):523-37.

NCBI and Uniprot Product Information

• NCBI GI #: 100913206
• NCBI GeneID: 1660
• NCBI Accession #: NP_001348
• NCBI GenBank Nucleotide #: NM_001357
• UniProt Accession #: Q08211
• Molecular Weight: 141kDa
• NCBI Official Full Name: ATP-dependent RNA helicase A
• NCBI Official Synonym Full Names: DExH-box helicase 9
• NCBI Official Symbol: DHX9
• NCBI Official Synonym Symbols: LKP; RHA; DDX9; NDH2; NDHII
• NCBI Protein Information: ATP-dependent RNA helicase A
• UniProt Protein Name: ATP-dependent RNA helicase A
• Protein Family: ATP-dependent RNA helicase
• UniProt Gene Name: DHX9
• UniProt Synonym Gene Names: DDX9; LKP; NDH2; RHA; LKP; NDH II
• UniProt Entry Name: DHX9_HUMAN

NCBI Description

This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 11 and 13.[provided by RefSeq, Feb 2010]

Uniprot Description

DDX9: a helicase that unwinds double-stranded DNA and RNA in a 3' to 5' direction. Interacts with the RNA-induced silencing complex (RISC) in human cells and functions in RISC loading. Generates multiple secondary structures that influence RNA-binding proteins. Has a dsRNA binding motif at the N-terminus, RGG-box at the carboxyl terminus, and a bidirectional nuclear transport domain of 110 amino acids at the carboxyl terminus. May play a role in X-linked gene expression.

Protein type: Nuclear receptor co-regulator; Spliceosome; Nucleolus; Helicase; RNA splicing; EC 3.6.4.13; RNA-binding; RNA processing

Chromosomal Location of Human Ortholog: 1q25

Cellular Component: nucleoplasm; centrosome; membrane; cytoplasm; nucleolus; nucleus; ribonucleoprotein complex; cytosol

Molecular Function: ATP-dependent DNA helicase activity; protein binding; DNA binding; ATP-dependent RNA helicase activity; ATP binding; RNA helicase activity

Biological Process: osteoblast differentiation; circadian rhythm; RNA processing; nuclear mRNA splicing, via spliceosome; RNA splicing; positive regulation of interferon type I production; innate immune response; gene expression; DNA duplex unwinding