Mouse DHX38 Monoclonal Antibody | anti-DHX38 antibody

DHX38 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 38, DDX38, KIAA0224, PRP16, PRPF16) (MaxLight 650)

Cat. Num. AAA6227228

• Gene Names: DHX38; DDX38; PRP16; PRPF16
• Applications: Western Blot
• Purity: Purified
• Synonyms: DHX38; Monoclonal Antibody; DHX38 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 38; DDX38; KIAA0224; PRP16; PRPF16) (MaxLight 650); DEAH (Asp-Glu-Ala-His) Box Polypeptide 38; PRPF16; anti-DHX38 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B9
• Specificity: Recognizes DHX38.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

• Applicable Applications for anti-DHX38 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: DHX38 (NP_054722.2, 342aa-450aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPEPVIPVKDATSDLAIIARKGSQT
• Conjugate: MaxLight650
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-DHX38 antibody

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a member of the DEAD/H box family of splicing factors. This protein resembles yeast Prp16 more closely than other DEAD/H family members. It is an ATPase and essential for the catalytic step II in pre-mRNA splicing process. [provided by RefSeq]

Product Categories/Family for anti-DHX38 antibody

Antibodies; DEAH Box Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 41406095
• NCBI GeneID: 9785
• NCBI Accession #: NP_054722.2
• NCBI GenBank Nucleotide #: NM_014003
• Molecular Weight: 60,743 Da
• NCBI Official Full Name: Homo sapiens DEAH (Asp-Glu-Ala-His) box polypeptide 38 (DHX38), mRNA
• NCBI Official Synonym Full Names: DEAH (Asp-Glu-Ala-His) box polypeptide 38
• NCBI Official Symbol: DHX38
• NCBI Official Synonym Symbols: DDX38; PRP16; PRPF16
• NCBI Protein Information: pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16; ATP-dependent RNA helicase DHX38; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38; DEAH box protein 38; PRP16 homolog of S.cerevisiae; pre-mRNA splicing factor ATP-dependent RNA helicase PRP16

NCBI Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a member of the DEAD/H box family of splicing factors. This protein resembles yeast Prp16 more closely than other DEAD/H family members. It is an ATPase and essential for the catalytic step II in pre-mRNA splicing process. [provided by RefSeq, Jul 2008]