Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse DGKE Monoclonal Antibody | anti-DGKE antibody

DGKE (Diacylglycerol Kinase epsilon, DAG Kinase epsilon, Diglyceride Kinase epsilon, DGK-epsilon, DAGK5) APC

Gene Names
DGKE; DGK; DAGK5; DAGK6; NPHS7
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DGKE; Monoclonal Antibody; DGKE (Diacylglycerol Kinase epsilon; DAG Kinase epsilon; Diglyceride Kinase epsilon; DGK-epsilon; DAGK5) APC; anti-DGKE antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG3, lambda
Clone Number
7E1
Specificity
Recognizes human DGKE. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-DGKE antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa141-241 from DGKE (NP_003638) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFGEFKNLIIPPSYLTSINQMRKDKKTDYEVLASKLGKQWTPLIILANSRSGTNMGEGLLGEF*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(DGKE monoclonal antibody Western Blot analysis of DGKE expression in HeLa.)

Western Blot (WB) (DGKE monoclonal antibody Western Blot analysis of DGKE expression in HeLa.)

Western Blot (WB)

(DGKE monoclonal antibody Western Blot analysis of DGKE expression in PC-12.)

Western Blot (WB) (DGKE monoclonal antibody Western Blot analysis of DGKE expression in PC-12.)

Western Blot (WB)

(DGKE monoclonal antibody Western Blot analysis of DGKE expression in Raw 264.7.)

Western Blot (WB) (DGKE monoclonal antibody Western Blot analysis of DGKE expression in Raw 264.7.)
Related Product Information for anti-DGKE antibody
Highly selective for arachidonate-containing species of diacylglycerol (DAG). May terminate signals transmitted through arachidonoyl-DAG or may contribute to the synthesis of phospholipids with defined fatty acid composition.
Product Categories/Family for anti-DGKE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,927 Da
NCBI Official Full Name
diacylglycerol kinase epsilon
NCBI Official Synonym Full Names
diacylglycerol kinase, epsilon 64kDa
NCBI Official Symbol
DGKE
NCBI Official Synonym Symbols
DGK; DAGK5; DAGK6; NPHS7
NCBI Protein Information
diacylglycerol kinase epsilon; DGK-epsilon; DAG kinase epsilon; diglyceride kinase epsilon
UniProt Protein Name
Diacylglycerol kinase epsilon
Protein Family
UniProt Gene Name
DGKE
UniProt Synonym Gene Names
DAGK5; DAG kinase epsilon; DGK-epsilon
UniProt Entry Name
DGKE_HUMAN

Uniprot Description

DGKE: Highly selective for arachidonate-containing species of diacylglycerol (DAG). May terminate signals transmitted through arachidonoyl-DAG or may contribute to the synthesis of phospholipids with defined fatty acid composition. Belongs to the eukaryotic diacylglycerol kinase family.

Protein type: Lipid Metabolism - glycerolipid; Lipid Metabolism - glycerophospholipid; Membrane protein, multi-pass; Membrane protein, integral; EC 2.7.1.107; Motility/polarity/chemotaxis; Kinase, lipid

Chromosomal Location of Human Ortholog: 17q22

Cellular Component: membrane; cytoplasm; integral to membrane; plasma membrane

Molecular Function: metal ion binding; diacylglycerol kinase activity; ATP binding; NAD+ kinase activity

Biological Process: platelet activation; protein kinase C activation; blood coagulation; phosphorylation; phospholipid biosynthetic process

Disease: Nephrotic Syndrome, Type 7

Similar Products

Product Notes

The DGKE dgke (Catalog #AAA6136225) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DGKE (Diacylglycerol Kinase epsilon, DAG Kinase epsilon, Diglyceride Kinase epsilon, DGK-epsilon, DAGK5) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DGKE can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DGKE dgke for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DGKE, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.