Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.85kD).)

Mouse anti-Human DFF45 Monoclonal Antibody | anti-DFF45 antibody

DFF45 (DNA Fragmentation Factor Subunit alpha, DNA Fragmentation Factor 45kD Subunit, DFF-45, Inhibitor of CAD, ICAD, DFFA, DFF1, H13) (HRP)

Gene Names
DFFA; DFF1; ICAD; DFF-45
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DFF45; Monoclonal Antibody; DFF45 (DNA Fragmentation Factor Subunit alpha; DNA Fragmentation Factor 45kD Subunit; DFF-45; Inhibitor of CAD; ICAD; DFFA; DFF1; H13) (HRP); anti-DFF45 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A11
Specificity
Recognizes human DFFA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DFF45 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa231-331 from human DFFA (NP_004392.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.85kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.85kD).)

Testing Data

(Detection limit for recombinant GST tagged DFFA is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DFFA is 0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP3 and DFFA. HeLa cells were stained with CASP3 rabbit purified polyclonal 1:1200 and DFFA mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP3 and DFFA. HeLa cells were stained with CASP3 rabbit purified polyclonal 1:1200 and DFFA mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-DFF45 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,522 Da
NCBI Official Full Name
DNA fragmentation factor subunit alpha isoform 1
NCBI Official Synonym Full Names
DNA fragmentation factor, 45kDa, alpha polypeptide
NCBI Official Symbol
DFFA
NCBI Official Synonym Symbols
DFF1; ICAD; DFF-45
NCBI Protein Information
DNA fragmentation factor subunit alpha; DFF45; inhibitor of CAD; DNA fragmentation factor 45 kDa subunit
UniProt Protein Name
DNA fragmentation factor subunit alpha
UniProt Gene Name
DFFA
UniProt Synonym Gene Names
DFF1; DFF45; DFF-45; ICAD
UniProt Entry Name
DFFA_HUMAN

NCBI Description

Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DFFA: Inhibitor of the caspase-activated DNase (DFF40). Heterodimer of DFFA and DFFB. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase

Chromosomal Location of Human Ortholog: 1p36.3-p36.2

Cellular Component: nucleoplasm; nuclear chromatin; cytoplasm; lipid particle; nucleus; cytosol

Molecular Function: protein binding

Biological Process: positive regulation of apoptosis; apoptosis; DNA fragmentation during apoptosis; cell structure disassembly during apoptosis

Research Articles on DFF45

Similar Products

Product Notes

The DFF45 dffa (Catalog #AAA6152128) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DFF45 (DNA Fragmentation Factor Subunit alpha, DNA Fragmentation Factor 45kD Subunit, DFF-45, Inhibitor of CAD, ICAD, DFFA, DFF1, H13) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DFF45 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DFF45 dffa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DFF45, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.