Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-PCCA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit PCCA Polyclonal Antibody | anti-PCCA antibody

PCCA antibody - N-terminal region

Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PCCA; Polyclonal Antibody; PCCA antibody - N-terminal region; anti-PCCA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI
Sequence Length
728
Applicable Applications for anti-PCCA antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 86%; Dog: 86%; Horse: 83%; Human: 100%; Mouse: 77%; Pig: 86%; Rabbit: 86%; Rat: 86%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PCCA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PCCA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-PCCA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-PCCA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-PCCA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-PCCA antibody
This is a rabbit polyclonal antibody against PCCA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PCCA is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA is the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia.The protein encoded by this gene is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA encodes the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PCCA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
propionyl-CoA carboxylase alpha chain, mitochondrial isoform a
NCBI Official Synonym Full Names
propionyl-CoA carboxylase subunit alpha
NCBI Official Symbol
PCCA
NCBI Protein Information
propionyl-CoA carboxylase alpha chain, mitochondrial
UniProt Protein Name
Propionyl-CoA carboxylase alpha chain, mitochondrial
UniProt Gene Name
PCCA
UniProt Entry Name
PCCA_HUMAN

NCBI Description

The protein encoded by this gene is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA encodes the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2010]

Uniprot Description

PCCA: Defects in PCCA are the cause of propionic acidemia type I (PA-1). PA-1 is a life-threatening disease characterized by episodic vomiting, lethargy and ketosis, neutropenia, periodic thrombocytopenia, hypogammaglobulinemia, developmental retardation, and intolerance to protein. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Amino Acid Metabolism - valine, leucine and isoleucine degradation; EC 6.4.1.3; Ligase; Carbohydrate Metabolism - propanoate

Chromosomal Location of Human Ortholog: 13q32

Cellular Component: mitochondrial matrix; cytosol

Molecular Function: enzyme binding; metal ion binding; propionyl-CoA carboxylase activity; biotin carboxylase activity; ATP binding; biotin binding

Biological Process: fatty acid beta-oxidation; vitamin metabolic process; short-chain fatty acid catabolic process; cellular lipid metabolic process; water-soluble vitamin metabolic process; biotin metabolic process

Disease: Propionic Acidemia

Research Articles on PCCA

Similar Products

Product Notes

The PCCA pcca (Catalog #AAA3201311) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCCA antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PCCA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the PCCA pcca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LYYSRQCLMV SRNLGSVGYD PNEKTFDKIL VANRGEIACR VIRTCKKMGI. It is sometimes possible for the material contained within the vial of "PCCA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.