<
Western Blot (WB)
(Western Blot detection against Immunogen (63.07kD).)
Mouse anti-Human DEF6 Monoclonal Antibody | anti-DEF6 antibody
DEF6 (Differentially Expressed in FDCP 6 Homolog, DEF-6, IBP, IRF4-binding Protein)
Gene Names
DEF6; IBP; SLAT; SWAP70L
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
DEF6; Monoclonal Antibody; DEF6 (Differentially Expressed in FDCP 6 Homolog; DEF-6; IBP; IRF4-binding Protein); Anti -DEF6 (Differentially Expressed in FDCP 6 Homolog; anti-DEF6 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F2
Specificity
Recognizes human DEF6.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQR
Applicable Applications for anti-DEF6 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Full length recombinant corresponding to aa1-337 from human DEF6 (AAH17504) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (63.07kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (63.07kD).)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to DEF6 on formalin-fixed paraffin-embedded human lymph node [antibody concentration 3ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to DEF6 on formalin-fixed paraffin-embedded human lymph node [antibody concentration 3ug/ml].)
Immunoprecipitation (IP)
(Immunoprecipitation of DEF6 transfected lysate using DEF6 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DEF6 monoclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of DEF6 transfected lysate using DEF6 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DEF6 monoclonal antibody.)
Testing Data
(Detection limit for recombinant GST tagged DEF6 is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged DEF6 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-DEF6 antibody
Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which plays a role in the activation of Rho GTPases RAC1, RhoA and CDC42. Can regulate cell morphology in cooperation with activated RAC1. Plays a role in Th2 (T helper cells) development and/or activation, perhaps by interfering with ZAP70 signaling.
Product Categories/Family for anti-DEF6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
73,910 Da
NCBI Official Full Name
differentially expressed in FDCP 6 homolog
NCBI Official Synonym Full Names
differentially expressed in FDCP 6 homolog (mouse)
NCBI Official Symbol
DEF6
NCBI Official Synonym Symbols
IBP; SLAT; SWAP70L
NCBI Protein Information
differentially expressed in FDCP 6 homolog; DEF-6; IRF4-binding protein; SWAP-70-like adaptor protein of T cells
UniProt Protein Name
Differentially expressed in FDCP 6 homolog
Protein Family
UniProt Gene Name
DEF6
UniProt Synonym Gene Names
IBP; DEF-6
UniProt Entry Name
DEFI6_HUMAN
NCBI Description
DEF6, or IBP, is a guanine nucleotide exchange factor (GEF) for RAC (MIM 602048) and CDC42 (MIM 116952) that is highly expressed in B and T cells (Gupta et al., 2003 [PubMed 12923183]).[supplied by OMIM, Mar 2008]
Uniprot Description
DEF6: Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which plays a role in the activation of Rho GTPases RAC1, RhoA and CDC42. Can regulate cell morphology in cooperation with activated RAC1. Plays a role in Th2 (T helper cells) development and/or activation, perhaps by interfering with ZAP70 signaling.
Protein type: GEFs; GEFs, Rac/Rho
Chromosomal Location of Human Ortholog: 6p21.33-p21.1
Cellular Component: membrane; cytoplasm; plasma membrane; intercellular junction; nucleus
Research Articles on DEF6
Similar Products
Product Notes
The DEF6 def6 (Catalog #AAA6001716) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DEF6 (Differentially Expressed in FDCP 6 Homolog, DEF-6, IBP, IRF4-binding Protein) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DEF6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the DEF6 def6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MALRKELLKS IWYAFTALDV EKSGKVSKSQ LKVLSHNLYT VLHIPHDPVA LEEHFRDDDD GPVSSQGYMP YLNKYILDKV EEGAFVKEHF DELCWTLTAK KNYRADSNGN SMLSNQDAFR LWCLFNFLSE DKYPLIMVPD EVEYLLKKVL SSMSLEVSLG ELEELLAQEA QVAQTTGGLS VWQFLELFNS GRCLRGVGRD TLSMAIHEVY QELIQDVLKQ GYLWKRGHLR RNWAERWFQL QPSCLCYFGS EECKEKRGII PLDAHCCVEV LPDRDGKRCM FCVKTATRTY EMSASDTRQR QEWTAAIQMA IRLQAEGKTS LHKDLKQKRR EQREQR. It is sometimes possible for the material contained within the vial of "DEF6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
