Mouse DDX56 Monoclonal Antibody | anti-DDX56 antibody

DDX56 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 56, DDX21, DDX26, NOH61) (FITC)

Cat. Num. AAA6177059

• Gene Names: DDX56; DDX21; DDX26; NOH61
• Applications: Western Blot
• Purity: Purified
• Synonyms: DDX56; Monoclonal Antibody; DDX56 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 56; DDX21; DDX26; NOH61) (FITC); DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 56; NOH61; anti-DDX56 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6B9
• Specificity: Recognizes DDX56.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-DDX56 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: DDX56 (NP_061955, 450aa-547aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPPALRGLVRPHKKRKKLSSSCRKAKRAKSQNPLRSFKHKGKKFRPTAKPS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in HeLa (Cat # L013V1).)

Western Blot (WB)

(DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in HepG2 (Cat # L019V1).)

Western Blot (WB)

(DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in PC-12 (Cat # L012V1).)

Western Blot (WB)

(DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in NIH/3T3.)

Western Blot (WB)

(DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in Raw 264.7.)

Testing Data

(Detection limit for recombinant GST tagged DDX56 is 0.1 ng/ml as a capture antibody.)

Related Product Information for anti-DDX56 antibody

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene shows ATPase activity in the presence of polynucleotides and associates with nucleoplasmic 65S preribosomal particles. This gene may be involved in ribosome synthesis, most likely during assembly of the large 60S ribosomal subunit. [provided by RefSeq]

Product Categories/Family for anti-DDX56 antibody

Antibodies; DEAD Box Proteins

References

1. Quantitative Proteomics and Dynamic Imaging of the Nucleolus Reveal Distinct Responses to UV and Ionizing Radiation.Moore HM, Bai B, Boisvert FM, Latonen L, Rantanen V, Simpson JC, Pepperkok R, Lamond AI, Laiho M.Mol Cell Proteomics. 2011 Oct;10(10):M111. 009241. Epub 2011 Jul 21.

NCBI and Uniprot Product Information

• NCBI GI #: 9506931
• NCBI GeneID: 54606
• NCBI Accession #: NP_061955
• NCBI GenBank Nucleotide #: NM_019082.3
• UniProt Accession #: Q9NY93; Q6IAE2; Q9H9I8; A4D2K9; C9JV95
• Molecular Weight: 64.0 kDa (570aa)
• NCBI Official Full Name: probable ATP-dependent RNA helicase DDX56 isoform 1
• NCBI Official Synonym Full Names: DEAD-box helicase 56
• NCBI Official Symbol: DDX56
• NCBI Official Synonym Symbols: DDX21; DDX26; NOH61
• NCBI Protein Information: probable ATP-dependent RNA helicase DDX56
• UniProt Protein Name: Probable ATP-dependent RNA helicase DDX56
• Protein Family: Probable ATP-dependent RNA helicase
• UniProt Gene Name: DDX56
• UniProt Synonym Gene Names: DDX21; NOH61
• UniProt Entry Name: DDX56_HUMAN

NCBI Description

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene shows ATPase activity in the presence of polynucleotides and associates with nucleoplasmic 65S preribosomal particles. This gene may be involved in ribosome synthesis, most likely during assembly of the large 60S ribosomal subunit. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

DDX56: May play a role in later stages of the processing of the pre-ribosomal particles leading to mature 60S ribosomal subunits. Has intrinsic ATPase activity. Belongs to the DEAD box helicase family. DDX56/DBP9 subfamily.

Protein type: Nucleolus; Helicase; EC 3.6.4.13

Chromosomal Location of Human Ortholog: 7p13

Cellular Component: membrane; nucleolus

Molecular Function: ATP binding; ATP-dependent RNA helicase activity

Biological Process: rRNA processing