Mouse anti-Human DDX26 Monoclonal Antibody | anti-Ints6 antibody

DDX26 (Integrator Complex Subunit 6, DBI-1, Protein DDX26, Protein Deleted in Cancer 1, DICE1, INTS6, DBI1, DDX26A)

Cat. Num. AAA6003947

• Gene Names: Ints6; Ddx26; LRRGT00024
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: DDX26; Monoclonal Antibody; DDX26 (Integrator Complex Subunit 6; DBI-1; Protein DDX26; Protein Deleted in Cancer 1; DICE1; INTS6; DBI1; DDX26A); Anti -DDX26 (Integrator Complex Subunit 6; anti-Ints6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3D9
• Specificity: Recognizes human DDX26.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: DKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN*

• Applicable Applications for anti-Ints6 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in ELISA, Western Blot, Immunohistochemistry and Immunofluorescence.; Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml; Immunofluorescence: 10ug/ml
• Immunogen: Partial recombinant corresponding to aa779-888 from human DDX26 (NP_036273) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DDX26 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to INTS6 on HeLa cell . [antibody concentration 10ug/ml])

Related Product Information for anti-Ints6 antibody

Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes. May have a tumor suppressor role; an ectopic expression suppressing tumor cell growth.

Product Categories/Family for anti-Ints6 antibody

Antibodies; Abs to DEAD Box Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 149030246
• NCBI GeneID: 361057
• NCBI Official Full Name: DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26
• NCBI Official Synonym Full Names: integrator complex subunit 6
• NCBI Official Symbol: Ints6
• NCBI Official Synonym Symbols: Ddx26; LRRGT00024
• NCBI Protein Information: integrator complex subunit 6; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26
• Protein Family: Integrator complex