Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human DDX26 Monoclonal Antibody | anti-DDX26 antibody

DDX26 (Integrator Complex Subunit 6, DBI-1, Protein DDX26, Protein Deleted in Cancer 1, DICE1, INTS6, DBI1, DDX26A) (Biotin)

Gene Names
INTS6; HDB; INT6; DBI-1; DDX26; DICE1; DDX26A; Notchl2
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DDX26; Monoclonal Antibody; DDX26 (Integrator Complex Subunit 6; DBI-1; Protein DDX26; Protein Deleted in Cancer 1; DICE1; INTS6; DBI1; DDX26A) (Biotin); anti-DDX26 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D9
Specificity
Recognizes human DDX26.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
887
Applicable Applications for anti-DDX26 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa779-888 from human DDX26 (NP_036273) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DDX26 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to DDX26 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to INTS6 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to INTS6 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-DDX26 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
integrator complex subunit 6 isoform a
NCBI Official Synonym Full Names
integrator complex subunit 6
NCBI Official Symbol
INTS6
NCBI Official Synonym Symbols
HDB; INT6; DBI-1; DDX26; DICE1; DDX26A; Notchl2
NCBI Protein Information
integrator complex subunit 6
UniProt Protein Name
Integrator complex subunit 6
UniProt Gene Name
INTS6
UniProt Synonym Gene Names
DBI1; DDX26; DDX26A; Int6; DICE1
UniProt Entry Name
INT6_HUMAN

NCBI Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and is located in the critical region of loss of heterozygosity (LOH). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2015]

Research Articles on DDX26

Similar Products

Product Notes

The DDX26 ints6 (Catalog #AAA6141502) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DDX26 (Integrator Complex Subunit 6, DBI-1, Protein DDX26, Protein Deleted in Cancer 1, DICE1, INTS6, DBI1, DDX26A) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDX26 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDX26 ints6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDX26, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.