Western Blot (WB)
(DDEF1 monoclonal antibody (M02), clone 1B5. Western Blot analysis of DDEF1 expression in IMR-32 (Cat # L008V1).)
Mouse DDEF1 Monoclonal Antibody | anti-DDEF1 antibody
DDEF1 (ArfGAP with SH3 Domain, Ankyrin Repeat and PH Domain 1, AMAP1, CENTB4, DDEF1, KIAA1249, PAG2, PAP, ZG14P) (Biotin)
Gene Names
ASAP1; PAP; PAG2; AMAP1; DDEF1; ZG14P; CENTB4
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
DDEF1; Monoclonal Antibody; DDEF1 (ArfGAP with SH3 Domain; Ankyrin Repeat and PH Domain 1; AMAP1; CENTB4; KIAA1249; PAG2; PAP; ZG14P) (Biotin); ArfGAP with SH3 Domain; ZG14P; anti-DDEF1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B5
Specificity
Recognizes DDEF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1129
Applicable Applications for anti-DDEF1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DDEF1 (NP_060952, 1030aa-1129aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(DDEF1 monoclonal antibody (M02), clone 1B5. Western Blot analysis of DDEF1 expression in IMR-32 (Cat # L008V1).)
Western Blot (WB)
(DDEF1 monoclonal antibody (M02), clone 1B5. Western Blot analysis of DDEF1 expression in IMR-32 (Cat # L008V1).)
Western Blot (WB)
(DDEF1 monoclonal antibody (M02), clone 1B5. Western Blot analysis of DDEF1 expression in NIH/3T3 (Cat # L018V1).)
Western Blot (WB)
(DDEF1 monoclonal antibody (M02), clone 1B5. Western Blot analysis of DDEF1 expression in NIH/3T3 (Cat # L018V1).)
Related Product Information for anti-DDEF1 antibody
Mouse monoclonal antibody raised against a partial recombinant DDEF1.
Product Categories/Family for anti-DDEF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
NCBI Official Symbol
ASAP1
NCBI Official Synonym Symbols
PAP; PAG2; AMAP1; DDEF1; ZG14P; CENTB4
NCBI Protein Information
arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
UniProt Protein Name
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
UniProt Gene Name
ASAP1
UniProt Synonym Gene Names
DDEF1; KIAA1249; ARF GTPase-activating protein 1; DEF-1
UniProt Entry Name
ASAP1_HUMAN
NCBI Description
This gene encodes an ADP-ribosylation factor (ARF) GTPase-activating protein. The GTPase-activating activity is stimulated by phosphatidylinositol 4,5-biphosphate (PIP2), and is greater towards ARF1 and ARF5, and lesser for ARF6. This gene maybe involved in regulation of membrane trafficking and cytoskeleton remodeling. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Research Articles on DDEF1
Similar Products
Product Notes
The DDEF1 asap1 (Catalog #AAA6172644) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DDEF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDEF1 asap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDEF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
