Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.41kD))

Mouse anti-Human DDB1 Monoclonal Antibody | anti-DDB1 antibody

DDB1 (DNA Damage-binding Protein 1, DDB p127 Subunit, DNA Damage-binding Protein a, DDBa, Damage-specific DNA-binding Protein 1, HBV X-associated Protein 1, XAP-1, UV-damaged DNA-binding Factor, UV-damaged DNA-binding Protein 1, UV-DDB 1, XPE-binding Fact

Gene Names
DDB1; XPE; DDBA; XAP1; XPCE; XPE-BF; UV-DDB1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DDB1; Monoclonal Antibody; DDB1 (DNA Damage-binding Protein 1; DDB p127 Subunit; DNA Damage-binding Protein a; DDBa; Damage-specific DNA-binding Protein 1; HBV X-associated Protein 1; XAP-1; UV-damaged DNA-binding Factor; UV-damaged DNA-binding Protein 1; UV-DDB 1; XPE-binding Fact; anti-DDB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C5
Specificity
Recognizes human DDB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-DDB1 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Sandwich ELISA (Recombinant protein): The detection limit is ~0.3ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1044-1140 from human DDB1 (NP_001914) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.41kD))

Western Blot (WB) (Western Blot detection against Immunogen (36.41kD))

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DDB1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to DDB1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged DDB1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DDB1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-DDB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,611 Da
NCBI Official Full Name
DNA damage-binding protein 1
NCBI Official Synonym Full Names
damage-specific DNA binding protein 1, 127kDa
NCBI Official Symbol
DDB1
NCBI Official Synonym Symbols
XPE; DDBA; XAP1; XPCE; XPE-BF; UV-DDB1
NCBI Protein Information
DNA damage-binding protein 1; DDB p127 subunit; DNA damage-binding protein a; HBV X-associated protein 1; UV-DDB 1; UV-damaged DNA-binding factor; UV-damaged DNA-binding protein 1; XAP-1; XPE-binding factor; xeroderma pigmentosum group E-complementing pro
UniProt Protein Name
DNA damage-binding protein 1
UniProt Gene Name
DDB1
UniProt Synonym Gene Names
XAP1; DDBa; XAP-1; UV-DDB 1; XPE-BF; XPCe
UniProt Entry Name
DDB1_HUMAN

Uniprot Description

DDB1: the large subunit of theUV- damaged DNA-binding protein complex (the UV-DDB complex) required for DNA repair. The UV- DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The UV-DDB complex preferentially binds to cyclobutane pyrimidine dimers (CPD), 6-4 photoproducts (6-4 PP), apurinic sites and short mismatches. Also appears to function as a component of numerous distinct DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The functional specificity of the DCX E3 ubiquitin- protein ligase complex is determined by the variable substrate recognition component recruited by DDB1. DCX(DDB2) (also known as DDB1-CUL4-ROC1, CUL4-DDB-ROC1 and CUL4-DDB-RBX1) may ubiquitinate histone H2A, histone H3 and histone H4 at sites of UV-induced DNA damage. The ubiquitination of histones may facilitate their removal from the nucleosome and promote subsequent DNA repair. DCX(DDB2) also ubiquitinates XPC, which may enhance DNA-binding by XPC and promote NER. DCX(DTL) plays a role in PCNA-dependent polyubiquitination of CDT1 and MDM2-dependent ubiquitination of p53 in response to radiation-induced DNA damage and during DNA replication. DCX(ERCC8) (the CSA complex) plays a role in transcription-coupled repair (TCR). May also play a role in ubiquitination of p27kip when associated with CUL4 and SKP2. Component of the UV-DDB complex which includes DDB1 and DDB2. The UV-DDB complex interacts with monoubiquitinated histone H2A and binds to XPC via the DDB2 subunit. Component of numerous DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes which consist of a core of DDB1, CUL4A or CUL4B and RBX1. DDB1 may recruit specific substrate targeting subunits to the DCX complex. These substrate targeting subunits are generally known as DCAF (DDB1- and CUL4-associated factor) or CDW (CUL4-DDB1-associated WD40-repeat) proteins. Interacts with AMBRA1, ATG16L1, BTRC, DCAF1, DCAF17, DCAF16, DCAF15, DDA1, DET1, DTL, ERCC8, FBXW5, FBXW8, GRWD1, DCAF6, KATNB1, NLE1, NUP43, PAFAH1B1, PHIP, PWP1, RBBP4, RBBP5, RBBP7, RFWD2, SNRNP40, VPRBP, WDR5, WDR5B, WDR12, DCAF4, DCAF5, DCAF11, WDR26, DCAF10, WDR39, DCAF12, WDR42, DCAF8, WDR53, WDR59, WDR61, DCAF7, WSB1, WSB2 and WDTC1. DCX complexes may associate with the COP9 signalosome, and this inhibits the E3 ubiquitin-protein ligase activity of the complex. Interacts with NF2, TSC1 and TSC2. Interacts with Simian virus 5 protein V and the HBV X protein. Interaction with SV5 protein V may prevent the recruitment of DCAF proteins to DCX complexes. Interacts with EIF2C1 and EIF2C2. Associates with the E3 ligase complex containing DYRK2, UBR5, DDB1 and VPRBP proteins (EDVP complex). Interacts directly with DYRK2. Belongs to the DDB1 family.

Protein type: DNA repair, damage

Chromosomal Location of Human Ortholog: 11q12-q13

Cellular Component: nucleoplasm; extracellular space; cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; damaged DNA binding

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; positive regulation of viral genome replication; Wnt receptor signaling pathway; viral reproduction; nucleotide-excision repair; protein ubiquitination during ubiquitin-dependent protein catabolic process; nucleotide-excision repair, DNA damage removal; positive regulation of viral protein levels in host cell; interaction with symbiont; DNA repair; negative regulation of apoptosis

Similar Products

Product Notes

The DDB1 ddb1 (Catalog #AAA6146796) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DDB1 (DNA Damage-binding Protein 1, DDB p127 Subunit, DNA Damage-binding Protein a, DDBa, Damage-specific DNA-binding Protein 1, HBV X-associated Protein 1, XAP-1, UV-damaged DNA-binding Factor, UV-damaged DNA-binding Protein 1, UV-DDB 1, XPE-binding Fact reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDB1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Sandwich ELISA (Recombinant protein): The detection limit is ~0.3ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDB1 ddb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.